KZ
bin
Негізгі бет
Қазірдің өзінде танымал
Тікелей эфир
Ұнаған бейнелер
Қайтадан қараңыз
Жазылымдар
Кіру
Тіркелу
Ең жақсы KZbin
Фильм және анимация
Автокөліктер мен көлік құралдары
Музыка
Үй жануарлары мен аңдар
Спорт
Ойындар
Комедия
Ойын-сауық
Тәжірибелік нұсқаулар және стиль
Ғылым және технология
Жазылу
Tadasha Mishra
Hey everyone! This is Tadasha Mishra, A Fashion Blogger and Enthusiast. I’m extremely passionate about all things fashion, so this is the outlet I’ve chosen to bring you all into my world of vogue and tinted hues!
Getting clicked in my domain of happiness makes me the happiest, and that’s what I’m compassionate to show all of you.
Hopefully, it’s an insight that bridges the Fashion Blogger in me to the Enthusiast in you.
0:44
Tadasha X Shray - Sangeet Highlights
2 жыл бұрын
3:05
Our Sangeet Performance | Oh Humdum Suniyo Re, Ankhiyon Se Goli Maare, Uff Teri Ada
2 жыл бұрын
0:53
Fun Haldi Afternoon Teaser | Funtakshari | Haldi Games | Tadasha X Shray
2 жыл бұрын
1:27
Tadasha & Shray | Wedding Trailer| Beautiful Intimate Indian wedding
2 жыл бұрын
6:26
Trying Magnetic Eyelashes For The First Time In India| Honest Review of Calailas EyeLash - Hindi
3 жыл бұрын
7:59
Surprise Proposal In My Engagement Ceremony 💍 😍 | Best Bollywood Flash Mob Proposal Dance
3 жыл бұрын
9:46
The Body Shop India Honest Review 2021 | Best and worst products from The Body shop
4 жыл бұрын
1:02
Zara Haul 2021 - Must-Haves For A Capsule Wardrobe | Tadasha Mishra
4 жыл бұрын
2:55
7 Ways To Style a Maxi Dress | How To Style A Maxi Dress | Tadasha Mishra| Indian Outfit
4 жыл бұрын
5:00
How to get rid of pimples | Indian skin| Acne Treatment | Clear Skin | Tadasha Mishra
4 жыл бұрын
8:07
Trip to Coorg 2021 | Ayatana Resort | Coorg Travel Guide
5 жыл бұрын
2:39
8 Ways To Style A Little Black Dress | Styling Tips | Tadasha Mishra
5 жыл бұрын
8:42
Kama Ayurveda Best & Worst Products | Review | Tadasha Mishra
5 жыл бұрын
0:36
Summer ootd 2018
6 жыл бұрын
Пікірлер
@AmanByahut-q1i
21 күн бұрын
🥺
@AmanByahut-q1i
21 күн бұрын
😂😂😂
@AmanByahut-q1i
21 күн бұрын
Goosebumps 2.38❤❤
@AmanByahut-q1i
21 күн бұрын
😅😅
@himanityagi24
Ай бұрын
Thank you for your honest review ❤
@epsiloncentauri6067
Ай бұрын
Congratulations 🎊🍾
@Dj_ff646
2 ай бұрын
😫🤮🤮🤮🤮🤮 tauba tauba sara mood kharab kr diya
@malavathsunitha7864
3 ай бұрын
White shirt ka dance Kitna Acha hain aur wo bhi bhohut hand some hain❤
@priyamshukla3238
3 ай бұрын
Playlist mil skta hai
@sudikshasidhu
3 ай бұрын
Amazing❤❤❤🎉🎉🎉🎉
@mishalkhan5098
4 ай бұрын
Dance is very nice but back lights are so irritating to eyes
@eshitakrishnet2291
5 ай бұрын
The girl in grey has such beautiful eyes!!
@AdityaJeeShorts
4 ай бұрын
Yyy6 ya nhi hai y
@Biblio_phile026
6 ай бұрын
Aise cousins kaha milte hain?😢
@CuriousCluesSachHai
6 ай бұрын
Bhi aisae cousins to mil Jain gae pr on 4 logo ka Kya kro gae 😢😅❤
@shikharsharma9893
2 ай бұрын
Hamare paas 😊
@SakshiChawda-hw9lc
6 ай бұрын
Can I plz get audio track 🙏🙏
@AnitaYadav-ri8if
6 ай бұрын
First performance is energetic and nice performance 💫👏
@upsinghsingh6481
6 ай бұрын
Outstanding performance of. DESI GIRL 💟
@trendtales76
6 ай бұрын
It was best. Amazing
@MdSaif-pe4xs
7 ай бұрын
It was best😍. Amazing 🤩
@pizzabythebayk1855
7 ай бұрын
Hey can you please send the song used in the dance?
@waseemjilani1040
7 ай бұрын
yr ya white shirt wala larke kamal ha kia dance kia ha aur mujhe tu isa pyaar hoga ha
@ARTandCRAFT-i9i
7 ай бұрын
❤❤❤
@NiteshMehta-tu3en
8 ай бұрын
Nice dance💃❤❤❤❤
@Nxtyx_08
8 ай бұрын
doesnt he look like dancer buddy from instagram
@NikitaDas-c1r
9 ай бұрын
❤
@PriyaDiwate-c5c
9 ай бұрын
❤❤❤
@54shivanichauhan95
9 ай бұрын
Fabulous performance🎉 Bro Plz provide the audio of this blockbuster performance
@KusumGehlot-t4y
10 ай бұрын
Actually your dance is slow so next time you will be better practice
@kavyapunjabi6539
10 ай бұрын
Why do the boys almost always forget the steps or do it with almost no energy??😢 No hate though 😅 Lovely performance❤
@weddingbell7126
10 ай бұрын
watch this dance performance too kzbin.info/www/bejne/o2i3oqqIq5eSjM0
@saqibkhan5589
10 ай бұрын
Looking beautiful 🤩 saree, curves, belly, back 😘
@Balas_Mihir
10 ай бұрын
Hii
@mayuri_kawad
11 ай бұрын
Fabulous 😍....can I plz get the audio
@vanshikasikri1688
9 ай бұрын
Yes please give the audio
@ShivaniSonkar-x3c
11 ай бұрын
❤😊 good
@BhupendraRaghuwanshi-i8g
11 ай бұрын
😢❤ Nise
@deekshithshetty2887
Жыл бұрын
Gn❤😂😢🎉😮
@vankudothusujitha5030
Жыл бұрын
I need game jockey number
@faizan1482
Жыл бұрын
Osm dance performance 😍😍
@magicinphysics9829
Жыл бұрын
Wow so beautiful❤❤
@ketkiteravkar
Жыл бұрын
Justtty bestttt❤
@saumyarawat6469
Жыл бұрын
Mujh jese single ko partner dance nashib mei nahi likha hai........😢😅😅
@lifesituations2005
7 ай бұрын
Hum single ka yahi faayda hai kisi ke saath bhi dance kar sakte hai 😂
@subhashtiwari2691
6 ай бұрын
Same sister 😂😅
@khushdeep980
Жыл бұрын
nice
@rajlaxmipanda539
Жыл бұрын
Very beautiful Tadasha🎉
@kikkii.writes1656
Жыл бұрын
Bhai brown coat walo ko notice krna best h uska 😂
@Bharti-bq7xi
6 ай бұрын
😂❤
@mdjunaid2596
Жыл бұрын
Fjffkdkcvhygcndcmffcsmvmffcncccccuhggfbbfxmfmfmfd.ffmdffd.xtygmffftuihff
@anshikatiwari1000
Жыл бұрын
Best performance❤❤
@tadashamishra
Жыл бұрын
Thank you
@offline670
Жыл бұрын
Sob pahblek mela dan kora sob gora posason
@Baatein473
Жыл бұрын
Yrr.. Me sochri ki ye konsi family hy jisme sab itna acha dance krte hy
@sunildhule9518
Жыл бұрын
Ye Skyy Blue Waali Kitni ossm hain yrrrrr😍😍😘❣️🥀☺️
@kumkumgupta5292
Жыл бұрын
Very nice❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤
@mahisharma4956
Жыл бұрын
Nice
@AthiAnu583
Жыл бұрын
I just want to try this shade that's why I'm asking. Is this really worth?