AFRICAN HOME: THE BLACKMAILER (EPISODE 2)

[@Itsluminarywealth]

Ojo is one of the most creative content creator on KZbin, his videos are interesting every minute, kudos to his mom as well for doing such a good job of playing a role of Ojo's grandma and raising ojo in real life to be such creative, Love from India 🇮🇳

[@GXQ42]

Indeed, you can never get bored with his content

[@Flip-Playz]

His names sam i think but hes fine with ojo :)

[@Itsluminarywealth]

@@Flip-Playz his real name is Samuel Oluwafemi Osubiojo , so Sam or Ojo both are his real name ;)

[@AderomoluAdeyeri]

REERKAKWKKWLWLALEAKRMKAKEJAKRLARKJALWLELKRKWJRKRELEKQLRAKEKARAKRLJSKWKWLWKRAJWLWLWKEKRLKSRLAWKALEKALRLWJRLSKEAJELAKEAEKRKAALWLWKELWEALWKKEWLLWEAWKKRJKSKEKEAKRKALWLEKALEAKRKSKSKEKEKKLEESLEAWKWLKWLLE RRKSRLAKWAAEAKRSKWISKÀKKWKWLWKWAKEKKRMRKSKELS

[@AderomoluAdeyeri]

R,AKKWWKKWKKEWRKARLSLWLEAWLWKAEKALWKWKWWWLLWKKWEKWKEAKRAWWRYKWLWKEARALWMALWKLWWKKRKWAKWKLQKW RKWMWKWEYJLQQKQEKAKRAKAWKEKRNRJAKAJWWKEKWKKLWLLWLWRKEKEKAKWEKARNKAKAKWWKARAKWJEAWJKWWKWKKWKLWLLWRKRWEKAKEARKANAJAÀKWWKEKFKSWLKWKWKKEALWLAKE RRKRAKWKRJAKWEKRJAKWKWEAWAKWWKKEKJWLELELWLW 10:13

[@herlife3526]

This guy can act. I still can’t believe it is the same person playing all these roles 👌🏾❤️

[@sorfomaame4360]

Eeeeeiiiii so his the same person as mama ojo😂😂😂woowww

[@RealKxng]

That’s why he doesn’t upload that much

[@atwinecaroline7324]

Ohh i know it i didn't know that,it was refusing me thanks

[@fatmatakeita1876]

Me too

[@kwesiayepa3448]

Swears❤️❤️❤️ can someone tell him how much I love him Sampedy❤️❤️❤️❤️❤️❤️❤️😩❤️

[@meraboyugi7110]

This deserves an award... I have laughed 😂😂😂 keep it up SamSpedy. Good one

[@brookelynne6888]

Spedy is a GENIUS!!!😂 And I love Grandma. She is so wise.❤

[@its_Betty]

His real same is Sam not spedy hahah

[@sjjgamer4672]

@@its_Betty No one asked u though hahah

[@siahyoung6335]

@@its_Betty His real same is Sam? SamSpedy, Sam or Spedy whatever... Give it up, it's not that serious

[@its_Betty]

@@siahyoung6335 I never said it was fuck off my gosh always starting drama like this

[@xxmercedex]

@@sjjgamer4672 no one asked you

[@eunicevugutsa9218]

I love how ojo brings out the characters so well man you're talented

[@denniskamau5656]

Ojo will forever remain my favorite comedian,,,he is so talented God bless this guy🙏,,love from Kenya

[@virginiawanjiru7248]

BOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOORING

[@dekosmalo]

Vvvvvv😮😮😮😮❤❤❤❤

[@AnnuSia]

Love this attitude of Ojo 😂 I know it won’t last long.

[@pufta5952]

Eh ojo

[@thomasshihango4726]

Keep it Sam team

[@irenenjuguna6623]

time to get it tomorrow and prove to it yourself you want it yourself hair color for free nitarundisha me know when your prayers 🙏 I can get it tomorrow bye bye man

[@jaishankar5094]

Soon he will taste that slap of fire 🔥

[@jaysonmundia6388]

@@pufta5952 fb

[@kekiplus1andonly]

Ojo is bad on all aspects for real🤣🤣everything he does always affects people 🤣🤣🤣its that beating he's been missing for months🤣🤣🤣he never espererit🤣🤣🤣

[@shakurwonders5216]

truth na

[@carolinemuriuki3865]

@@shakurwonders5216 qà

[@kamellebutler2317]

yes it is call hit in the back

[@deinmadiri1010]

The Advice given by the Grandmother to the parents is something we need to learn from. It is priceless👍👍

[@kekiplus1andonly]

Ojo looking bomb in that black swagg today🤩🤩🤩🤩🤩fine boy🤩🤩🤩

[@salhamrisho8138]

Shoga sikuwezi kila kona upo kumbe😆😇🥰🤌👌

[@JanetRosesB]

@@salhamrisho8138 😂

[@fabiolajohnson2039]

@@salhamrisho8138 lll

[@KeelsM.]

👌🔥🔥

[@kekiplus1andonly]

@@salhamrisho8138 🤣🤣🤣🤣acha tu shoga angu ,nakwambia sipitwi..kha!!hatari sana

[@sandismith9909]

This was hilarious!!!! At the end when they cornered Ojo, I was like, yaaaasssss, team work make the dream work😂😂😂😂👍

[@mkhayoz1686]

OJOO I SALUTE U BRUU your work is exceptional I give you all the creditThis is like your calling bruuuuu

[@LyricVideos-rp2wf]

Ojo really said “I don’t want peace, I want problems” when he sent the mum the picture 🤣🤣🤣🤣🤣🤣🤣love these videos

[@zackattack9673]

This is the greatest comedy He is the goat of comedy he deserves 50 million subscribers

[@angeloann5945]

That's kind of an exaggeration, don't you think?

[@yes9515]

At least 5 mil

[@Ft237-x3q]

Mark angel >

[@yes9515]

@@Ft237-x3q agreed

[@melariccapatton2423]

I knew it was over when I saw there was no escape... and he realized it when he said "when I run this way".... it was over for it... but Ojo knew his life was about to end 😂😂😂😂 I love this guy so much...I can see him really making it big, Love from Kenya 🇰🇪

[@kekiplus1andonly]

You really be mumu ojo🤣🤣🤣mumu man you will leave the house empty handed🤣🤣🤣

[@deboraezekiel784]

Hahahah ojo ur done

[@gigi-tv9er]

Legend bacon hair 2017

[@VGTV578]

Mama ojo is packing🧳clothes she never wears. 😂😂😂😂😂always in one wrapper till Jesus returns.

[@stepstep865]

HAHAHAHAHAHHAHAHA EXACTLY

[@xcentrikservicesltd5293]

Spot on

[@lindabitwayiki2474]

Excaty 😂😂😂😂😂😂

[@NthabisengLetsatsi]

🤣🤣🤣🤣

[@undertakerbae]

🤣🤣🤣

[@annek9231]

I love how mama Ojo and papa Ojo joined forces at the end 🥺😂😂

[@Pretty.Og1]

The end was so funny, the way Ojo gave up was something else😂😂

[@mariont2961]

I always forget that mam Ojo has a beard. This guy is so perfect in his acting. We love you Ojo💞 lots of love to your mum too, for being part of your acting 🌹🌹🌹

[@anythingbarca7612]

'

[@tracynoel9065]

Sam you're amazing. I'm always scrolling my phone checking on KZbin for your videos . Each time I don't find any new ones , I feel bad. U have greatly improved.... Much Love from Uganda 🇺🇬💜

[@FlorenceSomses]

Genius absolute genius! 😂The last part of Ojo between his parents finished me and the background song🤣🤣🤣🤣 I can't stop laughing😂😂😂😂

[@vanessawilson4190]

I've been waiting for this part 2 oohh , still can't believe its one person acting 3 roles😊😂

[@arsports8]

“Mama mama... daddy daddy...” Mama, can't you forgive like daddy...does he have two heads” 😂😂🤣🤣

[@FatouGaye-d6c]

Hi

[@lizz6555]

am early enough today....🙏🙏🤣🤣good job ojo and your panel ...We as Kenyans 🇰🇪🇰🇪🇰🇪do really enjoy your videos 🤣🤣

[@Scenes04]

Ojo and the cast deserve Grammy awards 🤣🤣🤣

[@whotheheckiseyosias]

So just Sam because he is Femi and His mom..?

[@IllaDillaJ]

Oscar*

[@joshola353]

He is the cast😂

[@mechamogaka6964]

For real 😳 give this man the trophy

[@ch4is]

@@whotheheckiseyosias his mom too dummy

[@EfphyaDinky]

The song @ the end😂😂😂😂😂 #did I disappoint you😂😂😂

[@ekemodeaminat_1]

The part he calls his grandma 👵🏽 and she didn’t pick it made me laugh and I said in my head that is killed🤣

[@nolxve_amari2918]

@@prankmebiko1989 where's number five :( I was enjoying it 🙁

[@young_justice]

This guy is so in character that i really want to meet the whole family one day😂😂😂😊😂😂😂😂

[@asiaalsnani4020]

Thanks for all may God bless dear

[@tashnahtv6098]

😄... I like your insanity.

[@janel36619]

Yep😁😁😁😁

[@cornlol1806]

the family is only ojo his mum is him his dad is him

[@brandyneptune903]

😂😂😂same

[@hildajohn3065]

Mama Ojo u dey make me laugh himmmmm .. your acting is so real as if you're brought into this world to make people laugh 😂😂😂

[@Animatevr]

GRANDMA’S SLAP CLEARED THE SITUATION😂😂🇷🇼

[@FRN1-19]

Hoooowwww i first reading this comment while watching the video . You spoiled the end🥺

[@SD__161]

Same

[@SD__161]

@@FRN1-19 he ruined it for me as well

[@FRN1-19]

@@SD__161 dat is klote

[@emelyneza]

Komera 🇷🇼

[@kukuaekuban997]

The facial expressions alone especially at the end was a masterpiece 😄Samspeeeedyyyy👏👏👏👏👏👏👏👏

[@emmanuelalimetikitutu7331]

Ojo World wide, stellar acting performance from this man. Every character🌍👏👌

[@favourites9106]

And absolute genius. And my gosh he looks just like his mum. She’s also very talented. A thousand 👏🏾

[@mechamogaka6964]

🙌🏾 yess

[@queenkariuki]

He os oneand the same person 😂😂😂😂

[@favourites9106]

@@queenkariuki I know But his real mum is also in the skit. As the mother’s mother and mother in law...of the father, of which he plays both parts..

[@adnen7944]

@@favourites9106 hi

[@adnen7944]

@@mechamogaka6964 hi

[@uwasedorcas1292]

Lemme take this time and appreciate him literally the best comedian 💕💕☺️

[@jameskathoka4859]

Very creative scene ,,,always best Sam #mamaojo,,Great🥰❤❤🔥🔥💪💪

[@mechamogaka6964]

This is by far he’s best episode of the year 🔥🔥💯🎯 idk what anyone says or does this is the one (2022) ALL PROPS TO SAM!!! 😂 very enjoyable!

[@tashnahtv6098]

...and his life flashed before him. Goodbye indeed... 😄. Your mother is just fantastic in these skits. Her performance in this one especially was award-winning.

[@nawaalaadanabdi2694]

Mama ojo is the same character as papa ojo and ojo

[@UjunwaBlessingOkonkwo-rr1pq]

Hahaha I done laugh 😂😂. Trie infant this one sweet me pass up to you mama ojo papa. Ojo and ojo too

[@ramirondongmba2365]

No subscriber can say that this isn't the best we've seen ojo since the start of his KZbin career. Great job,ojo! Keep it up!

[@febbieknsenga481]

It's grandma's reaction after ojo said we even have ghosts in this house for me 🤣🤣🤣 and the mama mama, papa papa part 🤣

[@kofiyesu3446]

Mr ojo when are u coming to Ghana 🇬🇭 Cos we would want to see u

[@innocenteakpabla8265]

Mr.ojo grandma's and after ojo said we even have ghosts in this house.🤓🤓🤓💔💔

[@warissulub8793]

so true.

[@peaceofori8063]

She low key said " You say"

[@yewandegiwa7199]

Wow

[@mpanamashile3901]

BLACKMAILER Part 2, baby! Absolutely love it!! But beginning and ending killed me🤣🤣🤣🤣💖🤣🤣

[@jenelleewing2441]

Just hilarious to see her packing her bag. Mama Ojo has an assortment of clothes but always wears one 😅🤣🤣🤣😭😭😭😭 HE DOES AN EXCELLENT JOB OF MAINTAINING EACH CHARACTER'S PERSONALITY. 💯😏👌💯

[@monialishaakram5186]

Da way she doesn't change

[@divadonly]

🤣😂

[@jacquila8647]

🤣🤣🤣

[@nevergiveup5918]

😂😂

[@helenhusbands6861]

0w

[@MohamedAl02]

First one from Guinea 🇬🇳 thanks ojo to make us happy 😂👊🏾 I’m watching now 😂😂

[@Reuben8974]

I really admired how African respect their older ones❣️❣️

[@cyphusstanislaus]

The ending is everything that's stand for greatness in this video😂

[@Zappercraft21]

''Am I your oxygen?'' Hahaha! I died! 🤣🤣🤣

[@christoliteotoo3486]

The part that he said "we even have ghost in this house" got me off my bed from laughter 🤣🤣🤣

[@regischihwai7881]

❤

[@carlamatthew3681]

oh Lord i laughed so much for this episode. Ojo never learns. you just cant win against Mama Ojo. 🤣🤣🤣🤣🤣🤣🤣 awesome content dude. 💖💖💖💖💖💖💖

[@Therocksso]

I swear this guy makes my day every time he uploads vids 😭 ❤️ ❤️

[@samuelowusu-ansah1505]

fr

[@elyaselahi7691]

onggg

[@kwesiayepa3448]

Fr😩❤️❤️❤️

[@SasukeUchiha-ve5yc]

Me to

[@vibe-withdes9194]

Exacly

[@efiandemfonjie2434]

Ojo u are so creative I love all your videos Each time I watch them It always puts a smile on my face😹😹😹 keep up the good work

[@mojisoladeji]

When Mama Ojo said "I brought you into this world", i sincerely thought she'd follow it with "And I can take you out of it" 🤣

[@warissulub8793]

same here.

[@dharampaulnatacha5986]

🗣

[@_.tokien._]

Actuallyy!!!!

[@vibezzwithtassie2383]

Exactly😂

[@Ronaldo_4Life482]

A SLAP ALWAYS FIXES A ARGUMENT

[@cynthiamuiru4799]

This man never disappoints 💯💯and I love how he's trying out new video edits like the slomo and the songs he chooses that fit a particular scene😩👌he is truly talented💯Love from Kenya🇰🇪

[@veronicaharry7581]

This matter is over now so he can't black mail you again 😂

[@nathanluzitu7360]

I love this attitude of Ojo and I can’t believe Femi changed his attitude from being calm and nice to the same attitude just like Mama Ojo😂 Hopefully this attitude of Femi 😂😂😂 won’t change I just don’t understand why anyone especially Femi and Mama Ojo would have a son who was a funny and delightful comedian but changed into a rude and disrespectful son

[@elizabethirungu741]

🤣 🤣 🤣 🤣 🤣 🤣 🤣

[@Whistlesonthewind]

Ojo deserves it.

[@tajjidonmusiqyg6192]

They switched attitudes lol

[@josiahademiluyi4677]

@@Whistlesonthewind just why 😂

[@espoirahouissou3078]

I never comment your videos Samspedy but with this masterpiece I can just recognize your huge talent. You are above many in your domain. Keep improving, I do really enjoy your videos and you deserve an Oscar👊🏾👏🏾

[@favouredblessed2631]

And he hardly comment but I love his content♥️

[@sofiaasino1034]

S

[@sofiaasino1034]

@@favouredblessed2631 ffdffff

[@curls1090]

What's going on ojo Is awesome 😎

[@curls1090]

He is the best 😜😊😊😊🤣 and the one 🕐 is it 😊

[@jaliamwajuma1378]

I love samspedy comedy. In fact it is my favourite comedy. So amazing and funny it is. Mama ojo, ojo and femi 😂🤣🤣🤣🤣😂😂😂. Ojo is the one who caused this problem between them

[@maureenwaithera6553]

I love Ojo very much he dedicates himself to make sure we have a good day by keeping a smile on our faces

[@nuellalaryea9775]

Sometimes I even forget he's the same person 😂. He's so good❤️

[@jaylongoodridge3386]

Ojo made a video please I love all your video

[@FatouGaye-d6c]

❤❤❤❤❤❤❤❤❤❤❤❤❤❤ 10:45 ❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤ 10:48 ❤❤❤❤❤❤❤❤❤❤❤❤ 10:48 ❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤😂😂❤❤❤❤❤❤❤❤❤

[@iamwainaina]

Ojo has me laughing soo hard every time he uploads😂😂😂

[@Kameni395]

POV: you accidentally saw Ojo’s channel and now you are obsessed

[@lyricwilberg]

Best episode!!! 😂😂😂 When he couldn't even call Grandma back I was CRACKING up!!! 🤣🤣🤣

[@beautifulandrews]

he was blocked!!! 🤣

[@dlangisa1525]

The hand movement after the "Don't forget to take your son with you" part 😂😂😂

[@ministaryifaith6989]

After getting so much love at the end of video finally he have learnt to give love back ..(blackmail) mama ojo 😂😂😂😂

[@Ali_Sambo]

This episode was fire 😂😂😂🥰🥰🥰❤❤❤✔✔Much Love from South Africa❤

[@missdunn7439]

Grandmother has great advice! Love this episode

[@saabrenelhaddad1776]

I was watching this channel for over 2 years and I figured out that ojo can be very smart

[@kristal9081]

We even have ghosts in this house best part🤣🤣😂😂😂

[@emilyscott3011]

I haven’t watched it yet but I already know that I am going to be dying of laughter 😭😭

[@greenfierskull3744]

So true😭😩

[@kelllyabby5407]

Why y telling comments then when u haven’t watch it yet

[@theplum5047]

when she said let me get your handbag and just slapped her I was just laughing so hard also when he was ranting how he is faster and he realized it was a dead-end I burst out in laughter.

[@alexnyotumba9247]

Right on time this round 😂😂😂 why is Eunice always shaking her legs while sitting down kwanu?

[@deduels7948]

🤣🤣🤣🤣🤣😂🙆🏾‍♂️ Everything is in this house 🏡, we even have ghost 👻 in this house 🏡. Grandma 👵 face mmm when she heard ghost 👻 is in this house.

[@johnjay7188]

This is the best comedy this year 😂 l love it♥️

[@tallman-tv4049]

I really miss Grandma haha 😂 😂 she's here to settle the case I just love her 😍 😍 😍 Samspedy you really resemble your mom 😍😍😍😍 🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥 Na the background music day sweet me pass for the comedy😂😂😂😂😂

[@preppyxboba4370]

Ikk 😂😂🥰

[@lovablepenelope4739]

Yes that part

[@denwizzle9775]

That's true❤❤

[@jackwinnerhustler5576]

To be frank this guy is highly talented... His name should be included in the book of Legends 🔥

[@adafrank6645]

😂😂😂😂the way Ojo sits back and relax to watch the drama unfold after sending each text.

[@Itsluminarywealth]

Ojo's channel needs to reach 5 million asap, gonna recommend his video to everyone ❤️

[@dawekxtv6724]

Very true

[@MIMI-fn5fr]

ight???? His vids are awesome

[@wierdorobloxian6831]

me too

[@YtFlixxs]

He must also get verified

[@kyosiimireolivia6379]

Sure!. Ojo life is finish! 😀

[@GreaterRealms]

🤣🤣🤣🤣 ojo you will not kill me oo sometimes I forget it’s just one person,you are the best

[@d.a.dstudios7274]

😂😂😂😂😂 I'm laughing like a mad man in the living room. God bless you Ojo!!!😂😂😂😭😭😭😭

[@chinonyeihenetu4523]

Lolzz😁. Finally, he exposed the parents secrets individually. I'm always curious and enthralled to the continuation of the story.

[@ilysoisa]

THIS MAN BRO. 😭😂 he makes my day

[@condehali3863]

The part he said, we even have ghost in this house got me 😂

[@Tay_5963]

Ojo never disappoint us.😂😂👏

[@FrankypankyV8]

...but always disappoint mama Ojo... 🤣

[@Tay_5963]

@@FrankypankyV8 I know right 😂😂

[@KumbaFatty-y5n]

Yes ojo u are the best

[@KumbaFatty-y5n]

Ojo are you the one who play all this roles

[@dreyloyd]

It's the ending song for me 😂😂😂😂😂😂😂😂💔 Ojo you are a legend abeg ❤

[@queendior5174]

I have been a fun of ojo since 2017 So nice to see him try new things Ojo needs a golden trofy for his hard work 💘💘💘👌👌👏👏👏👏👏👏👏👏👏🤘🤘🤘🤘🤘👍👍

[@kwekuwina]

This is not just comedy but it dey advice us as well..thanks Samspeedy

[@jameskathoka4859]

Even you(mama ojo) and papa ojo combines can't catch me and the booom🤣🤣🤣

[@bernardbrowne5205]

I would like to see him on the big screen one day, he is really good at acting 👌 👏 👍 😉

[@thee_heavens1401]

It’s ojo sitting calmly in the Sofa while his parents are giving it to each other for me 😂😂

[@NANCYMutegi-rk6ti]

😂😂😂😂😂😂😂😂

[@OryxOil]

fsggz ...yuyeueus❤ ishwji😂😂😂😂hdkjsjujskdkkjhej. jwiwiwoiiw

[@DevineLoved]

What you give is what you get is a life lesson amen ! Lmao the ending was funny af 😂😂😂😂 with that song 😂😂😂

[@stephiezvidzayi943]

I love you guys for putting a smile on our faces ❤❤❤❤❤ Big up to Sam speedy and crew you're the best guys may God continues to bless you guys😍😍❤❤ love all the way from Zimbabwe 🇿🇼🇿🇼

[@zeelicious5656]

As always Amazing work I’m always in awe of how well everything is put together from the acting 🎭 to the music 🎶 and more 🙌🏽👏🏽

[@lindokuhleknowledge6574]

The song kills me and the part mama papa , do you think you can catch me?😅😅😅😂😂😂😂

[@modoulaminceesay7912]

Grandma ojo never disappoint me 😂😂😂 does slaps

[@mechamogaka6964]

Facts 💯

[@zahariahjoe1357]

The part when femi said ' dont forget to take your son with you ' I literally died

[@vuduff5102]

Hbic from

[@kingndedaprofits6725]

i just needed a reason to subscribe and hit the notification bell. Mad respect from Kenya😃🤜

[@gracedenyigba9822]

I really laugh hard 😂😂😂... It's the ending for me 😂

[@Jennifer08587]

Lmao, can't stop laughing! This ep is amazing!🤣

[@iyamuanthonia4259]

Grandma you are welcome back 😍😍😍😍, am really enjoying this all your episode Samspedy, keep it up

[@veraclemmons3659]

This was worth the wait omg...LMAO I was waiting for it and I love you guys my day starts out with watching and my granddaughter she' loves watching I watch the old videos over and over bring such laughter to my soul.

[@Dylan-ii5es]

I like how mama ojo has a suitcase of clothes but only wears one outfit 😭😭😭

[@iamdamarea_leah]

🤣🤣🤣🤣🤣🤣

[@velmanyamusi7838]

😅😅😅

[@npc...O-k2n]

Finally a funny comment

[@hellensingoey2269]

Ojo caused the trouble between his parents and actually solved it all by himself 😂😂😂😂

[@holguyantoine7298]

Right

[@preciousreally4361]

Not all by himself his grandmother helped

[@iamselina8454]

​@@preciousreally4361/mother