Aur Kya | Phir Bhi Dil Hai Hindustani | Full Song | Shah Rukh Khan | Juhi Chawla

[@tushargurav4550]

Bachpan me pohoch gaya mein . ......... SRK with Juhi all time best couple as per acting skill , looks and chemistry which they delivered in every film

[@rehanamili4717]

SRK & Juhi chemistry is really underrated 💔 I found them so cute & attractive together!! ❤️

[@HassanAli-yr8jv]

I love srk juhi far more than Srkajol

[@rehanamili4717]

@@HassanAli-yr8jv completely agreed!

[@status1186]

मुझे परेशान ना करने वाली सब एक्टर्स महत्व पूर्ण है

[@dibakarchoudhury6835]

सही है

[@daijiro4918]

@@HassanAli-yr8jv actually its magic of srk See him in ladki badi anjani with kajol in k2h2 Or are re are with madhuri in dil to pagal h

[@MoyeMoyeEmployee]

Juhi Chawla - most beautiful and talented actress from 90's

[@simonswamy688]

All the comments are about abhijeet Shah Rukh Khan and juhi chawla but let's give credit to Jatin Lalit for an amazing composition what melody man it gives me goosebumps

[@sweetlibra1302]

I literally searched for this song to just watch Juhi Chawla....she is pure beauty...💕 flashback of childhood😓

[@CW-rx2js]

Me too! And a good actress too

[@HazelSmith-d8o]

I agree ❤

[@AnandiShankar]

Me too I am a great fan of hers… she is THE BEST ❤️😢she is not doing anymore films .

[@user-harsh22_]

Her beauty peaked here 🤩

[@paulinedoorgen7242]

Gosh never gets weary looking at video clips of Juhi and Shah Rukh.. this pair is so mesmerizing and their theme work says it all.. how I wish to see a reunion of them in a film once again.. Shah Rukh and Juhi makes the best jodi couple on Indian screen.

[@JS-yj4cx]

Right 👍

[@kimberlychako7269]

Agree

[@jyotitawde2443]

Right

[@CW-rx2js]

Juhi Chawla is ethereal. Just another level of beauty 😍 2:37 nobody can match her among today's fake actresses

[@Shridhar_8080]

This song is really so beautiful, the voices, the sets, the performance and both the actors, juhi and Shahrukh looked perfect together❤❤❤

[@riyadhrafique8377]

Shah Rukh Khan & Juhi Chawla in their prime!!! This was the time when they did Yes Boss (1997) & Duplicate (1998) along with Phir Bhi Dil Hai Hindustani (1999).

[@mohibquadri4053]

Raju ban gya gentleman & One two ka four also..

[@CW-rx2js]

@@mohibquadri4053 yeah but Raju BGG was in the early 90s

[@jiminncimjinhyungiloveyoui678]

kalian suka gak lagu ini

[@rekhasilta4314]

Srk jd juhi onscreen cutest funny nd luvabele couple in bollywood......no 1 jodi.....inke samne sari jodiyan fail

[@majalanmajalan8664]

🤍Assam 🇮🇳

[@user-fk8md4jn3i]

The charm of srk till date is unmatchable

[@haroonkapoor8233]

srk is good looking right??

[@kapiloryou]

People often say about AR Rehman but I will always that Jatin Lalit are the most soulful music director truly legend 🙌

[@sushilpurohit3080]

Absoulty brother. That duo of jatin ji lalit ji is unmatchable. 💓💓💓

[@RakeshVerma-my6rl]

I m totally agree with you bro

[@aniketroy7623]

Ekdum sahi kaha. Mai humesha yehi keheta hu toh sab bura mante hai. But AR Rehman ka music aisa kuch khas hai nahi. Yes thoravdiffrnt lagta hai.bura nahi hai but aisa bhi kuch out of thr box nahi hai

[@abdulraheemalmujaddedi5696]

Ssss,ssssssks ddwiu

[@jairajpuri2165]

You forgot t about Nadeem shravan, they brought back melodious music trend in 90s..

[@anushahegde9774]

Abhijeet Bhattacharya has a heavenly magical voice.He has the capacity to make a dull song interesting. Shahrukh Khan and Juhi Chawla make a good onscreen pair. Love this song😍😍🎶🎶

[@yourblackstar19]

He has a trashy personality so that kind of ruins it for me.. I try to ignore it while enjoying the song

[@prasantapandaprasanta8824]

@@yourblackstar19 Hume matter nahi karta... Kyunki abhijeet da k hum fan Hai... Sab ka apna apna najariya hota Hai.. Tum sale log wohi ho jo india ko intollrent bolte Hai aur tum unko support karte ho

[@maxamudsaciidbile9273]

@Ankita Srivastava.you.hcobpyyh. 9 Humph B Hp Mn Hope N . 0j. ..9hpb.pnop.p B.9blhP ..l on.mlj pypp00.g9l.l.nn.. .nlloopp.9bbblyhpp9j00mpm0pm.mhm99n.jpjj.9bnp ppob9pllopohl 9.ho9pph.9. Lljpo..9hhhhj h9b..php.9g.bhllNhNi 9 Gn9lopph H onMllmpo

[@maxamudsaciidbile9273]

@Ankita Srivastava.you.hcobpyyh. 9 Humph B Hp Mn Hope N . 0j. ..9hpb.pnop.p B.9blhP ..l on.mlj pypp00.g9l.l.nn.. .nlloopp.9bbblyhpp9j00mpm0pm.mhm99n.jpjj.9bnp ppob9pllopohl 9.ho9pph.9. Lljpo..9hhhhj h9b..php.9g.bhllNhNi 9 Gn9lopph H onMllm

[@nripendrachakma2921]

yr

[@HabiburRahman-qw6hp]

I can't believe my beloved SRK is getting old.. I want him young and joyfull for my lifetime.. Love you SRK

[@prabhauniyal1959]

Habibur Rahman I think u also came at this age since childhood

[@burman5017]

Brother your beloved parent's also getting old to older. Please take care of them.

[@realdeal9177]

Even you , me and everyone in the comments getting old, nothing last forever... enjoy it

[@riaj5426]

The song is soo romantic. I blush all the time imagining myself with my to be better half. The melody is soo calm, soft and full of love.

[@invista4134]

One of the very few songs of Bollywood, that is on my top 5 list. Yes I agree, Shah Rukh and Juhi had an amazing chemistry in this song.

[@amu_1911]

Srk gives me goosebumps whenever I see him smile..he has such a magnetic persona

[@haroonkapoor8233]

srk is good looking right? I mean his face??

[@bigthinker0]

@@haroonkapoor8233 ofcourse ❤️❤️❤️😘

[@haroonkapoor8233]

@@bigthinker0 what do you find in srks face good looking tell me honestly??

[@haroonkapoor8233]

@@bigthinker0 which parts of his face??

[@bigthinker0]

@@haroonkapoor8233 smile ❤️❤️❤️😘😘

[@aryaa_dixit]

The Song is Visually, Lyrically, Musically Perfect. A Classic in its own Right. It's sad that we don't get to see songs like this anymore.

[@IntruderAbhi]

Every one talks about SRK Kajol chemistry but SRK and Juhi chemistry also at that level.

[@arpitapanigrahy3551]

But juhi aisa legend hai koi bat world ko dikhana nahi chahata hai srk juhi best friend and couple

[@JS-yj4cx]

Right 👍

[@kimberlychako7269]

Better

[@kavik8376]

​@@JS-yj4cx1apaaqa😊q😊@@aa paaqqaqpp😊😊pp😊alap😊

[@srinivassajjan954]

I don't think so😂

[@ajaydhayfule1673]

Repeat after me : SRK and Abhijeet's songs are the best thing has happened in hindi music industry 🖤

[@tapiyafication]

Yessss absolutely

[@hrishisalunke3627]

After this... Emraan n himesh duo😎

[@ajaydhayfule1673]

@@hrishisalunke3627 Emraan and KK too ❤️

[@fareedathahir]

Is SRK ears sri Lankan foods

[@fareedathahir]

Does he eats red bananas

[@CW-rx2js]

Juhi - so beautiful, graceful and humble!! A true beauty queen :) pageant winners back then were more beautiful and poised!

[@vinodkumaarr4133]

Whenever Abhijeet has sung for SRK its been pure magic. Just hope they get together again..

[@beingsolo80]

Abhijeet was his lucky charm. SRK went down after breaking that link.

[@surajpatel5200]

with Abhijeet's reputation in recent years its never going to happen

[@vinodiyer2948]

Have not seen a person with so much of head weight....good singer but bad behaviour..... i have seen his concerts & he just doesn't seem to change

[@drshaimaaniazy6641]

Sorry the magic come from srk only

[@vinodkumaarr4133]

Dr shaimaa niazy Don't agree, magic was both ways...

[@game_changer991]

Voice of Abhijeet... Juhi and Shahrukh... Damn.. It's great... Our childhood memories....!.. Always will be there.....

[@prernasinha1536]

You forgot Alka Yagnik!!

[@game_changer991]

@@prernasinha1536 Oh yes..Alka ji ...Of course!!!! How could I forgot to mention her...

[@syedawazihaakhter6068]

Credit must go to the singers , actors , composers and every other single person connected to this evergreen song ❤

[@nasreenparveen3383]

T

[@AnandiShankar]

Yes I definitely agree with you and also to the whole Orchestra team . They are THE SPINE but Alas! We focus on hero and heroines .😒always.

[@thinkshine9522]

You forgot the legend- the Javed Saahab

[@SarfarajShah]

The 90's & early 20's produced some amazing melodies. I can literally play them on my music system & everybody likes it.

[@SN-ug4qe]

Why Bollywoodians can't create films like these now? Such a lovely chemistry with decent outfits. Of course the film too Love from Sri Lanka ❤ 2K19 Nov

[@Mr.TanvirBengal]

Because Bollywood doesn't like to be Bollywood. Bollywood wants to be Hollywood. Lack of self respect ... Nothing else! I'm a Canadian Bangladeshi.. And undoubtedly a good viewer of Indian films. I still don't get why did they name it "Bollywood"?

[@savitanagill]

Hyerrqe to h ya fir bhi nahi hote h ki ring and to hear it from the air in the e mail to you think we can be used for your time hi I am a uui

[@savitanagill]

Gdhxhxgx in a y y ie eyryueie email eur j eiei i in regards to hear from you soon and to hear from you soon and will

[@PK-rn4lo]

This film had flopped, lol. On a serious note though, today's bollywood is filled with star kids with one particular talent (when they do have one) that is showcased in every of their film and this dumb generation Z swoons all over stupid films.

[@novihanindya9948]

2021

[@abagthiari9666]

SHARUKHS facial/eyes expressions are,.. KILLING😆💘👍JUHI Gorgeous eyes Sweet smile,..👏 Music/lyrics/voice/singing/acting/picturisation,..MEMORABLE😆ROMANTIC👏

[@mydestination7827]

SRK at the peak of his career was Invincible! Nobody was even close to him in the late '90s and early 2000s. ❤ with Love from Bangladesh.

[@the_epiclore_]

1993-2009 was the SRK era ❤️❤️

[@nishchintdesai7991]

@@the_epiclore_ 1993-till date!

[@the_epiclore_]

@@nishchintdesai7991 sorry but I feel 1993-2013 , after that his career started going downhill

[@ananyadhaka5048]

1993-forever

[@Greymatter23]

Srk is the best thing that could happen to this industry..... He is a phenomenon ..which started in the early 90s ..nd will remain till eternity

[@GauravSharma-zk3sz]

One of the most romantic song from 90's era. The melody is so calm and soothing that can't be explained though words. Just feel the magic.

[@kamakshijolly4156]

Year 2000

[@rahulpalit7250]

ģģg

[@cherrymathur3504]

Wmkwpwkqmoikkkekpkqoklk pop see ekwkwkwjepwwkwlwmejrowjpwkeekpwkwmewpmemwwmemekemel ekwkwkwjepwwkwlwmejrowjpwkeekpwkwmewpmemwwmemekemel jk w km Keke mk pl mk wlkwllwkwpwkpkqppkewkeikwkwmwlkwwojwlkkeke hi wiejekoenwne

[@veekkasdeshmukkh2797]

Excellent romantic song. So nice to hear. Abhijeet is best in singing romantic songs.

[@junaidmalana7874]

yess most romantic Song only love srk and juhi

[@miszwaheeda]

Their chemistry was undeniable! Need them together in a new movie ASAP!! 😍

[@JS-yj4cx]

💯 Agree

[@Fitness-z2q]

SRK is a king of Romance.... absolutely no one can take his place

[@dcompany148]

Abhijeet da's voice is an added advantage for shahrukh chutiya.

[@kalidassonawane6818]

@@dcompany148 matlab tum modibhakt ho 🤣

[@deepntom]

100% correct

[@reshavvo3173]

@@dcompany148 king ....of Bollywood 100 percent correct

[@dcompany148]

@@reshavvo3173 shahrukh 100% chutiya b hai bhai. Ye b such hai chutiya is king of romance in Bollywood 100% correct

[@daar483]

This type of Dream sequence or imaginative set were created till early 2000's, now no more. I feel sad that majority directors or Film makers of 90's or before have retired or died. Miss the filmmakers like Aziz Mirza , Yash Chopra and many others who gave quantity films to srk

[@fahimaahmed3188]

❤👍

[@sandeepshah105]

Yash Chopra is not of 2000's.

[@geetanjaliramkhelawon6510]

kkklllkkkkll

[@geetanjaliramkhelawon6510]

,dd,d,sslslsdksdlsslsls

[@swatigautam1916]

This totally happen because of technology

[@Tygicupsccseabaiasofficer]

90's most beautiful actress Juhi chawla ❤❤❤❤❤❤

[@rao433]

There's somethings magical about Shah-Juhi chemistry. Just out of this world !!

[@arungemini2001]

Ohhh gosh Juhi looks so stunning.. can any of today's actress like Jacquline, Kiara, Disha Patani & others can ever look so graceful.. love this song.. whenever i feel like listening something tranquilizing which can actually transpose to some other world, I listen to this song..

[@sameerqureshi988]

Z CA vvmBcbzvbb

[@dainabharrat1206]

😇

[@heisenberg9584]

Isse bhot zyada achhi dikhti hai.kya kuch bhi bolta hai yar

[@arpitapanigrahy3551]

@@heisenberg9584 😂😂😂😂 nice joke.

[@heisenberg9584]

@@arpitapanigrahy3551 there is nothing like joke in this. This is fact

[@souravmitra5191]

Every Sunday morning these song played in radio ❤️ we enjoyed a lot ❤️ Memories bring back ❤️

[@ahmadyasin8674]

My dream reunion Sirf ek gaane ke liye, bas ek SRK-Juhi Jatin-Lalit sir Abhijit sir-Alka Ji

[@SachinS-sf2vm]

Same ❤️

[@kumarisamarakoon4417]

Would like to see them together in present cinema...even as elderly characters..such a cute pair❤️

[@sepalikagunatillake2126]

The voices are out of this world ❤❤❤❤❤as well as actors 👌👌👌

[@rumani_chakraborty]

A song close to my heart since my childhood days..... Still listening to it. Love the chemistry between Shah Rukh Khan and Juhi Chawla.... Great lyrics and heart-touching melody. Songs like this never get old with time... Fresh forever.

[@sitifarhanimohdali8046]

may I know the lyrics in English? I am from Malaysia and I love this song but have no idea what this song is about...

[@arshaanz22]

Absolutely true

[@vaishalitupkar8955]

Seven heavens song.

[@jairamveljibhaipatel5791]

Jairam Patel

[@ashishmeshram9883]

Taja kab hota hai miss this a song tell me

[@rupeshjadhav4713]

Give the credit to *JATIN-LALIT* for their amazing music.

[@shantii5783]

Absolutely great music director Jatin- lalit

[@luzz99]

Jdjdjfjgjffjfjdjdf

[@rupeshjadhav4713]

@@luzz99 😂

[@muhammadadnan7771]

Jatin-lalit 💥💥

[@TheMartianMan]

Definitely

[@sumitakhati8846]

Where is the those goes gone...... Refreshing the mind more and more after listening this song 90s songs are just Wow☺️☺️☺️☺️

[@purnaprakashshrestha4102]

Shahrukh khan aur juhi chawala dono ki behad khubsoorat love chemistry aur laajawab geet.

[@Anumomo19]

I love Juhi Chawla, Kajol, Rani Mukherjee and Aishwarya opposite ShahRukh Khan❤❤❤❤❤❤❤ And Juhi Chawla is something else man she's so beautiful 💖

[@BestGeneralKnowledge]

I feel so proud and lucky to myself that I was born and raised between 80s and 90s era... golden era of Bollywood music has been ended after 2000 no singer can fill the gap of Kumar Sanu, Udit Narayan, Sonu Nigam, K. J. Yesudas, S. P. Balasubrahmanyam, Hariharan, Abhijeet Bhattacharya, Vinod Rathod, Alka Yagnik, Kavita Krishnamurthy, Anuradha Paudwal, Sukhwinder, K. S. Chithra ,Sadhana Sargam's singing and Lata Mangeshkar.....................💯👍🥰🌹❣

[@sahilmairale8096]

It hurt when I realise SRK is getting older day by day .... but he will always in our hearts forever ❤️❤️😇

[@snigdhamohapatra5096]

Are you a big SRK fan?

[@snigdhamohapatra5096]

Fan movie of SRK is based on you

[@mayurakhibarhoi5429]

@@snigdhamohapatra5096 🤣

[@karishmakumari4458]

Very hurtful🥺

[@chanindukavindyaattanayake3774]

Yes.not only srk but im a big fan of old superstars like vyjayanthimala.she was beautiful like a goddess.but now ☹️❤love from 🇱🇰🇮🇳

[@feliciafernandes2241]

Wow! This song has a dream like quality to it . Just watching the lead pair , makes you want to fall in love all over again! And Juhi looks ethereally beautiful !

[@sumitamondal4556]

Khub valo Gan

[@randolfwilliams9577]

nice song dear love shahrukh god bless shahrukh 4 ever

[@Mujjuiz1]

Wow Felicia,.... Simply adore the usage of the words, very beautifully put!

[@mridulak1166]

Totally agree.

[@bittsg6448]

Who's listening this song in 2024❤

[@dikostarwahlang2373]

Me❤

[@sapanaingole2239]

Me listening always

[@priyapubalan8903]

december 2017 and still a big fan. no one can beat juhi. she is an amazing star, always have and always will be

[@CW-rx2js]

Agree!

[@amanvishwakarma5349]

I M Leaving This Comment In Hope That Whenever Someone Like This...I Will Be Reminded Of This Masterpiece❤

[@astd9729]

What an unforgettable romantic composition by Jatin Lalit ji .Abhijit Da and Alka ji have made the song immortal.

[@omseif]

Juhi is so goregous and she is such a sweet person too ..she & Srk r love!

[@kimleendelacruz149]

As r5 rt 6g hi

[@vaishalitupkar8955]

Nice and molodious.

[@jasalbirthshira4900]

What a voice too

[@freedbird2145]

But juhi got married old man..only for money

[@queenofzee]

@@freedbird2145 SHE DID. MONEY TALKS. CLEARLY SHE IS HAPPY, THAT IS WHAT MADE HER HAPPY. THE OLD GUY IS STILL AROUND AND WILL BE FOR A LONG TIME TO COME :) IF SHE GOT MARRIED THINKING HE WILL BE GONE SOON - DID NOT HAPPEN - YOU LIVE ONCE i SAY - BUT THAT IS WHAT SHE CHOSE.

[@nenkhery]

Abhijeet's voice was the most suitable voice for SRK I thought....

[@alfarezelfatahillah1043]

agree. . abhijeet voice also similar enough with shahrukhan real voice in the movie. that's make it so pure

[@toniktryadi2683]

Abhijeet memang identik dg SRK. Udit Narayan identik Aamir Khan. Kumar Sanu identik dg Salman

[@sirajfriends25]

Udit-SRK Abhijeet-SRK Sonu-SRK

[@bablubaidya8306]

Yup

[@Sr_via1]

Suitable because of srk

[@momtazhassan6182]

🌹♥️🌿 I really love this video song.

[@sssst6497]

I have seen many Hindi films. She's truly special. Like today, we need to combine Deepika, Soonam, and Katrina together on one screen to approach her Charisma. Like come on, what she doesn't have in her prime? Her beauty not just beautiful, but gorgeous, so charming and stunning. Her smile with that such intoxicating eyes enough to kill your love, she's sexy too, and don't ask about how great her acting. Such mind-blowingly women. Even Mr. Yash Chopra called her 'The Most Indian Beauty'. She has everything that women dream of. Big Respect!

[@mujahidmd1654]

Bhai itni tarref 😯😯 But jo kuch bi tumne likha wo ek dum sahi. hai. She looks Magical.

[@junaidanwar999]

Absolutely true.

[@rjnskmr65]

Correct bro👍👍

[@زينبعالمي-ذ1ع]

Beautiful words really expresses mam juhi beauty

[@زينبعالمي-ذ1ع]

💓💓

[@kh7688]

Juhi and SRK have great chemistry together. They're both so sweet together.

[@avikgope4156]

Juhi is natural beauty with out any cosmetic surgery.

[@Shalinisingh-oj4ip]

Juhi chawla most beautiful woman on this planet n srk juhi made for each other n srk loves her so much in real n y not she is so beautiful so heavenly beautiful. Love u both so much

[@annappabe5910]

Shalini Singh was planning on it in the

[@damayanti4598]

Hushjtwhsulsh ÷¢÷`=Π`√°Π°°¢Π

[@rifky7796]

You're right

[@pratyushsinha6823]

I wish and pray... For 2 reunions 1. Shahrukh and Abhijeet 2. Jatin Lalit. (Together again) All four doing a movie together It will be dream come true for me.

[@dipzdes2480]

agree

[@recipesunboxing5563]

Juhi n Srk bhi

[@antaradas1878]

Same wish...

[@AjaySharma-bh4vo]

ha yr .. Jatin lalit 14 sal se alag h yrr .. ab tk tak to hajaro behtareen gane ban chuke hote

[@fluidmechanics8759]

RD Burman da and Kishore da

[@atieks9676]

Love this couple Juhi Chawla and Shahrukh Khan 💞👍

[@kanchanchoudhary2836]

Choreography of this song is so beautiful Background,colour combination everything ❤

[@ovijitbarua5451]

I still hve hopes to see SRK and Abhijeet would reunite again! Its only SRK who can make this happen.....We miss you the both singing pairs of SRK and Abhijeet....... Plz Sir,Bring Abhijeet back to Ur voice again🙏

[@bbmaths282]

Wow just awesome..... close your eyes and you will enter an another world...

[@bhumikadudhe8276]

When a legend merges with Legend, a super legend is formed. This is the case with SRK and Abhijeetji. Hope to see them together again.

[@saarcful]

Wowww, full of goosebumps & tears! It really brought my childhood back, one moment, I went to 1999 and back. It once again blossomed my old memories of teenage!

[@fahimaahmed3188]

❤👍

[@pritiag7134]

So true.

[@firdhaaulia7807]

They are the cutest!!!! 🫶🏻

[@jaibheem3267]

Kya aawaj hai yaar Ab kyo nhi aate iss tarhe ke singer's yaar 🥰🥰🥰🥰🥰🥰🥰

[@azriekamachannel4317]

2019...i like this song...namaste🇮🇳🙏🏿 from malaysia🇲🇾

[@guddangupta5625]

Jjgjjg

[@kowsar3208]

I'm 🇧🇩🇧🇩🇧🇩🥰🥰💪😎😎😎😍😍

[@nishantgupta6575]

This songs takes u to your dream imagination with your soulmate another universe...what a calm song...uhh❤

[@b.m.k7]

SHAHRUKH+ JUHI. AUR KYA. One of my favourite Jodi. 😍😍😍❤❤❤ Evergreen SHAHRUKH ❤❤❤❤❤❤❤❤❤

[@yesupillay6777]

My favorite Jodi...

[@sabihayasmin4081]

Meri vhi favourite jodi...

[@bestsongeversingh9995]

Yeahhh that's true this couple looked great in the film Yes Boss also ☺️☺️😎😎😁😁😁

[@kaushikdas47]

My favorite jodi.

[@mansichaudhari58]

Me too

[@golamsahaniyaz9065]

Legendary Abhijeet makes the song beautiful. Such a outstanding singer.

[@astd9729]

What a beautiful romantic composition by Jatin Lalit ji.They deserve really Padma Bhushan if you go through their compositions minutely you will say it tobe right

[@tanialexa10]

I looove Abhijeet and Alka, just perfect.

[@sufailhamid5625]

Sasha Talm Hi

[@nurseh9758]

Sasha Talm

[@biplobkhan9533]

Great song my life

[@asifam715]

Hi madem

[@Dinesh_Choudhary10]

Superb👌👌👌🎤🎤😘

[@krishnasingh3424]

It's Top songs of ...90 SRK With Juchi..☺☺☺☺

[@rajmun3113]

Raju

[@rajmun3113]

Nic song

[@Anjolina211]

I love this, please don’t ever delete. God bless you.

[@amarsaha2005]

I was 19 when I listened to it...After 20 yrs I am listening to it.feeling better.

[@infinitynetwork5605]

This movie and it's songs were way ahead of its time

[@Varalakshmi1516]

Srk ❤ Juhi best couple 😊

[@shwetagupta6046]

Srk and juhi has more charming.... Screen couple.... Super talented both.... Kaam se hi Dhikhta hai

[@muhammadnayeem3891]

Juhi srk nice couple

[@muhammadnayeem3891]

Ap kaha se hai Shweta g

[@RiteshBhanushali]

most romantic song of srk !

[@rohanihashim9794]

I love shk .

[@kumariching4699]

loveyou🎊🎊🎊🎊🎊🎊🎊

[@aesthetic67500]

🤗😊😁BACHPAN MEI MUJHE AISA LAGTA THA SRK AUR JUHI HI GAATE HAIN SONGS 😁. BILKUL PERFECT ❤ THIS IS ONE OF THE BEST SONGS and our generation is the last generation jo aaj v sunti hai ye songs🥺❤

[@pawanvishkarma3535]

I listened this song when I entered my first day of school in the year 2004.I was in school van and driver was listening this song .What a golden days they were 2000-2009 year.

[@fahimaahmed3188]

👍

[@starthawani3456]

❤️

[@ifrahmehr6030]

Favorite song since childhood.. Such a sweet couple Juhi and Sharukh make💞

[@adi-alfalfa]

Unmatchable on-screen pair It just wahoooo...,,👌👌

[@theaddictive7655]

Ufffff what a great song 🔥🔥 killed it ond juhi crossed all limits of cuteness 😘😘

[@Shalinisingh-oj4ip]

shahrukh n juhi r true soulmates no one can match their chemistry.

[@AsifAli-ol4wk]

We want them back on screen!

[@sunnymane5646]

yess

[@journey95far49]

@@AsifAli-ol4wk Never going to happen, SRK only works with the younger actresses now. Juhi has been too "old" since the mid 2000's

[@vijaypatil7269]

Absolutely right

[@MONUKHAN-bi8ml]

yes shalini

[@avisingh7001]

Beautiful song. Gave me goosebumps. SRK, Salman, Amir Khan got the best times. Late 90s early 2000s, these were magical times. Songs that made sense, simple and pure acting. Everything was natural. The Indian songs these days are such crap.

[@tastymusic3176]

The real king who was born with crown hidden but was exposed by nature. Finally he proved that he is the king of bollywood.

[@aparajitadas3723]

Shahrukh+ Juhi- "Shahi" jodi of bollywood...😍😘👍

[@Kavita_143]

Woow Such a beautiful song , I Love ShahRukh ❤💖 aisa lag raha ye song SRK aur Juhi dono ne hi gaaya hai 🤩. I really love this song ,🧡 ShahRukh and Abhijeet Combination is world's best Combo. 🥰Beautiful Song❤💖

[@Kavita_143]

❤❤❤❤ 17th Of July 2022 ❤❤❤❤ And Forever 😘❤🤩😍

[@novishartikaompusunggu6908]

Juhi ❤

[@sabrinayasminroshni3248]

This man lost everything in young age family mom dad his sister got depression then started his career by Seriel Bollywood debut by other rejected movies he never give up life true inspiration shahrukh khan sir😞😭😭😭

[@shakilkhan-xc9ub]

A tribute to Shahrukh Khan

[@kimberlychako7269]

We haven't seen SRK to be himself in movies in a long long time. That's cs he hasn't worked with Juhi in a while. Bring them back together now!!! no special appearance nonsense just on a full romantic movie

[@hari24Hh]

This song is just like Jannat❤❤❤

[@softskillspathshala5644]

Beautiful lyrics, silent soothing music, deadly combo SRK Juhi Abhijeet Alka Yagnik....jo ho dil mein kehdo... Aur kya. Refreshing Always 😀😀😀😀

[@RohitKumar-pu2pb]

Yeh gana solid no people empty Alley's streeets

[@rupshasil5881]

That grey and red colour combination gown ❤️ Such an unique palette ✨

[@thegolmei]

Such a beautiful song, lyrics, music n even the set...I still remember the lyrics..while playing antakshari whenever someone sing this song we used to sing together till the end...such was the magic of this song...loved it

[@impiyushhh]

Srk Sir + Abhijeet Sir = Melodies !!..!!😍😍😘😘!!.!!

[@adlinairianahashim7242]

.rwuc a kw aovw howv wba .tw mvs8v wk w vwigwbo .gs ancywivw ca s afbcmvw Fa sts cv nwv ge bscbwb Ca afs ba snvwvtwy vvs wh

[@adlinairianahashim7242]

.vxnbxbmoo emb dm .oo dnp dbdmboo .nxnbxo xhkool dnd Bdm dmbe m Ndm dboo d.bdb.dm

[@maibi2788]

op to Ms Johnson I have a lot of work to so much for dinner tonight if c and I will be in town for a few mins and see how you GG and it was the same as end and the money was taken out for a good times with

[@kishanverma786]

0:34 ❤❤❤❤

[@Emily-ez2pt]

One of the best song of srk... Looking so sweet srk