Bachpan me pohoch gaya mein . ......... SRK with Juhi all time best couple as per acting skill , looks and chemistry which they delivered in every film
@rehanamili47174 жыл бұрын
SRK & Juhi chemistry is really underrated 💔 I found them so cute & attractive together!! ❤️
@HassanAli-yr8jv3 жыл бұрын
I love srk juhi far more than Srkajol
@rehanamili47173 жыл бұрын
@@HassanAli-yr8jv completely agreed!
@status11863 жыл бұрын
मुझे परेशान ना करने वाली सब एक्टर्स महत्व पूर्ण है
@dibakarchoudhury68353 жыл бұрын
सही है
@daijiro49183 жыл бұрын
@@HassanAli-yr8jv actually its magic of srk See him in ladki badi anjani with kajol in k2h2 Or are re are with madhuri in dil to pagal h
@MoyeMoyeEmployee6 ай бұрын
Juhi Chawla - most beautiful and talented actress from 90's
@simonswamy6883 жыл бұрын
All the comments are about abhijeet Shah Rukh Khan and juhi chawla but let's give credit to Jatin Lalit for an amazing composition what melody man it gives me goosebumps
@sweetlibra13024 жыл бұрын
I literally searched for this song to just watch Juhi Chawla....she is pure beauty...💕 flashback of childhood😓
@CW-rx2js2 жыл бұрын
Me too! And a good actress too
@HazelSmith-d8o Жыл бұрын
I agree ❤
@AnandiShankar Жыл бұрын
Me too I am a great fan of hers… she is THE BEST ❤️😢she is not doing anymore films .
@user-harsh22_20 күн бұрын
Her beauty peaked here 🤩
@paulinedoorgen72422 жыл бұрын
Gosh never gets weary looking at video clips of Juhi and Shah Rukh.. this pair is so mesmerizing and their theme work says it all.. how I wish to see a reunion of them in a film once again.. Shah Rukh and Juhi makes the best jodi couple on Indian screen.
@JS-yj4cx Жыл бұрын
Right 👍
@kimberlychako7269 Жыл бұрын
Agree
@jyotitawde244311 ай бұрын
Right
@CW-rx2js Жыл бұрын
Juhi Chawla is ethereal. Just another level of beauty 😍 2:37 nobody can match her among today's fake actresses
@Shridhar_80807 ай бұрын
This song is really so beautiful, the voices, the sets, the performance and both the actors, juhi and Shahrukh looked perfect together❤❤❤
@riyadhrafique83772 жыл бұрын
Shah Rukh Khan & Juhi Chawla in their prime!!! This was the time when they did Yes Boss (1997) & Duplicate (1998) along with Phir Bhi Dil Hai Hindustani (1999).
@mohibquadri40532 жыл бұрын
Raju ban gya gentleman & One two ka four also..
@CW-rx2js2 жыл бұрын
@@mohibquadri4053 yeah but Raju BGG was in the early 90s
@jiminncimjinhyungiloveyoui6782 жыл бұрын
kalian suka gak lagu ini
@rekhasilta43143 жыл бұрын
Srk jd juhi onscreen cutest funny nd luvabele couple in bollywood......no 1 jodi.....inke samne sari jodiyan fail
@majalanmajalan86645 ай бұрын
🤍Assam 🇮🇳
@user-fk8md4jn3i4 жыл бұрын
The charm of srk till date is unmatchable
@haroonkapoor82333 жыл бұрын
srk is good looking right??
@kapiloryou3 жыл бұрын
People often say about AR Rehman but I will always that Jatin Lalit are the most soulful music director truly legend 🙌
@sushilpurohit30802 жыл бұрын
Absoulty brother. That duo of jatin ji lalit ji is unmatchable. 💓💓💓
@RakeshVerma-my6rl2 жыл бұрын
I m totally agree with you bro
@aniketroy76232 жыл бұрын
Ekdum sahi kaha. Mai humesha yehi keheta hu toh sab bura mante hai. But AR Rehman ka music aisa kuch khas hai nahi. Yes thoravdiffrnt lagta hai.bura nahi hai but aisa bhi kuch out of thr box nahi hai
@abdulraheemalmujaddedi56962 жыл бұрын
Ssss,ssssssks ddwiu
@jairajpuri21652 жыл бұрын
You forgot t about Nadeem shravan, they brought back melodious music trend in 90s..
@anushahegde97744 жыл бұрын
Abhijeet Bhattacharya has a heavenly magical voice.He has the capacity to make a dull song interesting. Shahrukh Khan and Juhi Chawla make a good onscreen pair. Love this song😍😍🎶🎶
@yourblackstar193 жыл бұрын
He has a trashy personality so that kind of ruins it for me.. I try to ignore it while enjoying the song
@prasantapandaprasanta88243 жыл бұрын
@@yourblackstar19 Hume matter nahi karta... Kyunki abhijeet da k hum fan Hai... Sab ka apna apna najariya hota Hai.. Tum sale log wohi ho jo india ko intollrent bolte Hai aur tum unko support karte ho
@maxamudsaciidbile92733 жыл бұрын
@Ankita Srivastava.you.hcobpyyh. 9 Humph B Hp Mn Hope N . 0j. ..9hpb.pnop.p B.9blhP ..l on.mlj pypp00.g9l.l.nn.. .nlloopp.9bbblyhpp9j00mpm0pm.mhm99n.jpjj.9bnp ppob9pllopohl 9.ho9pph.9. Lljpo..9hhhhj h9b..php.9g.bhllNhNi 9 Gn9lopph H onMllmpo
@maxamudsaciidbile92733 жыл бұрын
@Ankita Srivastava.you.hcobpyyh. 9 Humph B Hp Mn Hope N . 0j. ..9hpb.pnop.p B.9blhP ..l on.mlj pypp00.g9l.l.nn.. .nlloopp.9bbblyhpp9j00mpm0pm.mhm99n.jpjj.9bnp ppob9pllopohl 9.ho9pph.9. Lljpo..9hhhhj h9b..php.9g.bhllNhNi 9 Gn9lopph H onMllm
@nripendrachakma29213 жыл бұрын
yr
@HabiburRahman-qw6hp3 жыл бұрын
I can't believe my beloved SRK is getting old.. I want him young and joyfull for my lifetime.. Love you SRK
@prabhauniyal19592 жыл бұрын
Habibur Rahman I think u also came at this age since childhood
@burman50172 жыл бұрын
Brother your beloved parent's also getting old to older. Please take care of them.
@realdeal9177Ай бұрын
Even you , me and everyone in the comments getting old, nothing last forever... enjoy it
@riaj54263 жыл бұрын
The song is soo romantic. I blush all the time imagining myself with my to be better half. The melody is soo calm, soft and full of love.
@invista41343 жыл бұрын
One of the very few songs of Bollywood, that is on my top 5 list. Yes I agree, Shah Rukh and Juhi had an amazing chemistry in this song.
@amu_19113 жыл бұрын
Srk gives me goosebumps whenever I see him smile..he has such a magnetic persona
@haroonkapoor82333 жыл бұрын
srk is good looking right? I mean his face??
@bigthinker03 жыл бұрын
@@haroonkapoor8233 ofcourse ❤️❤️❤️😘
@haroonkapoor82333 жыл бұрын
@@bigthinker0 what do you find in srks face good looking tell me honestly??
@haroonkapoor82333 жыл бұрын
@@bigthinker0 which parts of his face??
@bigthinker03 жыл бұрын
@@haroonkapoor8233 smile ❤️❤️❤️😘😘
@aryaa_dixit2 жыл бұрын
The Song is Visually, Lyrically, Musically Perfect. A Classic in its own Right. It's sad that we don't get to see songs like this anymore.
@IntruderAbhi3 жыл бұрын
Every one talks about SRK Kajol chemistry but SRK and Juhi chemistry also at that level.
@arpitapanigrahy35513 жыл бұрын
But juhi aisa legend hai koi bat world ko dikhana nahi chahata hai srk juhi best friend and couple
@JS-yj4cx Жыл бұрын
Right 👍
@kimberlychako7269 Жыл бұрын
Better
@kavik83769 ай бұрын
@@JS-yj4cx1apaaqa😊q😊@@aa paaqqaqpp😊😊pp😊alap😊
@srinivassajjan9548 ай бұрын
I don't think so😂
@ajaydhayfule16733 жыл бұрын
Repeat after me : SRK and Abhijeet's songs are the best thing has happened in hindi music industry 🖤
@tapiyafication3 жыл бұрын
Yessss absolutely
@hrishisalunke36273 жыл бұрын
After this... Emraan n himesh duo😎
@ajaydhayfule16733 жыл бұрын
@@hrishisalunke3627 Emraan and KK too ❤️
@fareedathahir3 жыл бұрын
Is SRK ears sri Lankan foods
@fareedathahir3 жыл бұрын
Does he eats red bananas
@CW-rx2js2 жыл бұрын
Juhi - so beautiful, graceful and humble!! A true beauty queen :) pageant winners back then were more beautiful and poised!
@vinodkumaarr41336 жыл бұрын
Whenever Abhijeet has sung for SRK its been pure magic. Just hope they get together again..
@beingsolo804 жыл бұрын
Abhijeet was his lucky charm. SRK went down after breaking that link.
@surajpatel52004 жыл бұрын
with Abhijeet's reputation in recent years its never going to happen
@vinodiyer29484 жыл бұрын
Have not seen a person with so much of head weight....good singer but bad behaviour..... i have seen his concerts & he just doesn't seem to change
@drshaimaaniazy66414 жыл бұрын
Sorry the magic come from srk only
@vinodkumaarr41334 жыл бұрын
Dr shaimaa niazy Don't agree, magic was both ways...
@game_changer9914 жыл бұрын
Voice of Abhijeet... Juhi and Shahrukh... Damn.. It's great... Our childhood memories....!.. Always will be there.....
@prernasinha15364 жыл бұрын
You forgot Alka Yagnik!!
@game_changer9914 жыл бұрын
@@prernasinha1536 Oh yes..Alka ji ...Of course!!!! How could I forgot to mention her...
@syedawazihaakhter60683 жыл бұрын
Credit must go to the singers , actors , composers and every other single person connected to this evergreen song ❤
@nasreenparveen33832 жыл бұрын
T
@AnandiShankar Жыл бұрын
Yes I definitely agree with you and also to the whole Orchestra team . They are THE SPINE but Alas! We focus on hero and heroines .😒always.
@thinkshine9522 Жыл бұрын
You forgot the legend- the Javed Saahab
@SarfarajShah3 жыл бұрын
The 90's & early 20's produced some amazing melodies. I can literally play them on my music system & everybody likes it.
@SN-ug4qe5 жыл бұрын
Why Bollywoodians can't create films like these now? Such a lovely chemistry with decent outfits. Of course the film too Love from Sri Lanka ❤ 2K19 Nov
@Mr.TanvirBengal4 жыл бұрын
Because Bollywood doesn't like to be Bollywood. Bollywood wants to be Hollywood. Lack of self respect ... Nothing else! I'm a Canadian Bangladeshi.. And undoubtedly a good viewer of Indian films. I still don't get why did they name it "Bollywood"?
@savitanagill4 жыл бұрын
Hyerrqe to h ya fir bhi nahi hote h ki ring and to hear it from the air in the e mail to you think we can be used for your time hi I am a uui
@savitanagill4 жыл бұрын
Gdhxhxgx in a y y ie eyryueie email eur j eiei i in regards to hear from you soon and to hear from you soon and will
@PK-rn4lo3 жыл бұрын
This film had flopped, lol. On a serious note though, today's bollywood is filled with star kids with one particular talent (when they do have one) that is showcased in every of their film and this dumb generation Z swoons all over stupid films.
SRK at the peak of his career was Invincible! Nobody was even close to him in the late '90s and early 2000s. ❤ with Love from Bangladesh.
@the_epiclore_3 жыл бұрын
1993-2009 was the SRK era ❤️❤️
@nishchintdesai79913 жыл бұрын
@@the_epiclore_ 1993-till date!
@the_epiclore_3 жыл бұрын
@@nishchintdesai7991 sorry but I feel 1993-2013 , after that his career started going downhill
@ananyadhaka50483 жыл бұрын
1993-forever
@Greymatter233 жыл бұрын
Srk is the best thing that could happen to this industry..... He is a phenomenon ..which started in the early 90s ..nd will remain till eternity
@GauravSharma-zk3sz3 жыл бұрын
One of the most romantic song from 90's era. The melody is so calm and soothing that can't be explained though words. Just feel the magic.
@kamakshijolly41563 жыл бұрын
Year 2000
@rahulpalit72503 жыл бұрын
ģģg
@cherrymathur35043 жыл бұрын
Wmkwpwkqmoikkkekpkqoklk pop see ekwkwkwjepwwkwlwmejrowjpwkeekpwkwmewpmemwwmemekemel ekwkwkwjepwwkwlwmejrowjpwkeekpwkwmewpmemwwmemekemel jk w km Keke mk pl mk wlkwllwkwpwkpkqppkewkeikwkwmwlkwwojwlkkeke hi wiejekoenwne
@veekkasdeshmukkh27973 жыл бұрын
Excellent romantic song. So nice to hear. Abhijeet is best in singing romantic songs.
@junaidmalana78743 жыл бұрын
yess most romantic Song only love srk and juhi
@miszwaheeda2 жыл бұрын
Their chemistry was undeniable! Need them together in a new movie ASAP!! 😍
@JS-yj4cx Жыл бұрын
💯 Agree
@Fitness-z2q4 жыл бұрын
SRK is a king of Romance.... absolutely no one can take his place
@dcompany1484 жыл бұрын
Abhijeet da's voice is an added advantage for shahrukh chutiya.
@kalidassonawane68184 жыл бұрын
@@dcompany148 matlab tum modibhakt ho 🤣
@deepntom4 жыл бұрын
100% correct
@reshavvo31734 жыл бұрын
@@dcompany148 king ....of Bollywood 100 percent correct
@dcompany1484 жыл бұрын
@@reshavvo3173 shahrukh 100% chutiya b hai bhai. Ye b such hai chutiya is king of romance in Bollywood 100% correct
@daar4835 жыл бұрын
This type of Dream sequence or imaginative set were created till early 2000's, now no more. I feel sad that majority directors or Film makers of 90's or before have retired or died. Miss the filmmakers like Aziz Mirza , Yash Chopra and many others who gave quantity films to srk
@fahimaahmed31884 жыл бұрын
❤👍
@sandeepshah1053 жыл бұрын
Yash Chopra is not of 2000's.
@geetanjaliramkhelawon65103 жыл бұрын
kkklllkkkkll
@geetanjaliramkhelawon65103 жыл бұрын
,dd,d,sslslsdksdlsslsls
@swatigautam19163 жыл бұрын
This totally happen because of technology
@Tygicupsccseabaiasofficer5 ай бұрын
90's most beautiful actress Juhi chawla ❤❤❤❤❤❤
@rao4334 жыл бұрын
There's somethings magical about Shah-Juhi chemistry. Just out of this world !!
@arungemini20013 жыл бұрын
Ohhh gosh Juhi looks so stunning.. can any of today's actress like Jacquline, Kiara, Disha Patani & others can ever look so graceful.. love this song.. whenever i feel like listening something tranquilizing which can actually transpose to some other world, I listen to this song..
@sameerqureshi9883 жыл бұрын
Z CA vvmBcbzvbb
@dainabharrat12063 жыл бұрын
😇
@heisenberg95843 жыл бұрын
Isse bhot zyada achhi dikhti hai.kya kuch bhi bolta hai yar
@arpitapanigrahy35513 жыл бұрын
@@heisenberg9584 😂😂😂😂 nice joke.
@heisenberg95843 жыл бұрын
@@arpitapanigrahy3551 there is nothing like joke in this. This is fact
@souravmitra51913 жыл бұрын
Every Sunday morning these song played in radio ❤️ we enjoyed a lot ❤️ Memories bring back ❤️
@ahmadyasin86743 жыл бұрын
My dream reunion Sirf ek gaane ke liye, bas ek SRK-Juhi Jatin-Lalit sir Abhijit sir-Alka Ji
@SachinS-sf2vm3 жыл бұрын
Same ❤️
@kumarisamarakoon44174 жыл бұрын
Would like to see them together in present cinema...even as elderly characters..such a cute pair❤️
@sepalikagunatillake2126Ай бұрын
The voices are out of this world ❤❤❤❤❤as well as actors 👌👌👌
@rumani_chakraborty7 жыл бұрын
A song close to my heart since my childhood days..... Still listening to it. Love the chemistry between Shah Rukh Khan and Juhi Chawla.... Great lyrics and heart-touching melody. Songs like this never get old with time... Fresh forever.
@sitifarhanimohdali80467 жыл бұрын
may I know the lyrics in English? I am from Malaysia and I love this song but have no idea what this song is about...
@arshaanz226 жыл бұрын
Absolutely true
@vaishalitupkar89556 жыл бұрын
Seven heavens song.
@jairamveljibhaipatel57916 жыл бұрын
Jairam Patel
@ashishmeshram98836 жыл бұрын
Taja kab hota hai miss this a song tell me
@rupeshjadhav47135 жыл бұрын
Give the credit to *JATIN-LALIT* for their amazing music.
@shantii57834 жыл бұрын
Absolutely great music director Jatin- lalit
@luzz994 жыл бұрын
Jdjdjfjgjffjfjdjdf
@rupeshjadhav47134 жыл бұрын
@@luzz99 😂
@muhammadadnan77713 жыл бұрын
Jatin-lalit 💥💥
@TheMartianMan3 жыл бұрын
Definitely
@sumitakhati88463 жыл бұрын
Where is the those goes gone...... Refreshing the mind more and more after listening this song 90s songs are just Wow☺️☺️☺️☺️
@purnaprakashshrestha41024 жыл бұрын
Shahrukh khan aur juhi chawala dono ki behad khubsoorat love chemistry aur laajawab geet.
@Anumomo196 жыл бұрын
I love Juhi Chawla, Kajol, Rani Mukherjee and Aishwarya opposite ShahRukh Khan❤❤❤❤❤❤❤ And Juhi Chawla is something else man she's so beautiful 💖
@BestGeneralKnowledge Жыл бұрын
I feel so proud and lucky to myself that I was born and raised between 80s and 90s era... golden era of Bollywood music has been ended after 2000 no singer can fill the gap of Kumar Sanu, Udit Narayan, Sonu Nigam, K. J. Yesudas, S. P. Balasubrahmanyam, Hariharan, Abhijeet Bhattacharya, Vinod Rathod, Alka Yagnik, Kavita Krishnamurthy, Anuradha Paudwal, Sukhwinder, K. S. Chithra ,Sadhana Sargam's singing and Lata Mangeshkar.....................💯👍🥰🌹❣
@sahilmairale80963 жыл бұрын
It hurt when I realise SRK is getting older day by day .... but he will always in our hearts forever ❤️❤️😇
@snigdhamohapatra50962 жыл бұрын
Are you a big SRK fan?
@snigdhamohapatra50962 жыл бұрын
Fan movie of SRK is based on you
@mayurakhibarhoi54292 жыл бұрын
@@snigdhamohapatra5096 🤣
@karishmakumari44582 жыл бұрын
Very hurtful🥺
@chanindukavindyaattanayake37742 жыл бұрын
Yes.not only srk but im a big fan of old superstars like vyjayanthimala.she was beautiful like a goddess.but now ☹️❤love from 🇱🇰🇮🇳
@feliciafernandes22417 жыл бұрын
Wow! This song has a dream like quality to it . Just watching the lead pair , makes you want to fall in love all over again! And Juhi looks ethereally beautiful !
@sumitamondal45565 жыл бұрын
Khub valo Gan
@randolfwilliams95775 жыл бұрын
nice song dear love shahrukh god bless shahrukh 4 ever
@Mujjuiz14 жыл бұрын
Wow Felicia,.... Simply adore the usage of the words, very beautifully put!
@mridulak11663 жыл бұрын
Totally agree.
@bittsg6448Ай бұрын
Who's listening this song in 2024❤
@dikostarwahlang237313 күн бұрын
Me❤
@sapanaingole22392 сағат бұрын
Me listening always
@priyapubalan89036 жыл бұрын
december 2017 and still a big fan. no one can beat juhi. she is an amazing star, always have and always will be
@CW-rx2js3 жыл бұрын
Agree!
@amanvishwakarma53493 жыл бұрын
I M Leaving This Comment In Hope That Whenever Someone Like This...I Will Be Reminded Of This Masterpiece❤
@astd97293 ай бұрын
What an unforgettable romantic composition by Jatin Lalit ji .Abhijit Da and Alka ji have made the song immortal.
@omseif8 жыл бұрын
Juhi is so goregous and she is such a sweet person too ..she & Srk r love!
@kimleendelacruz1497 жыл бұрын
As r5 rt 6g hi
@vaishalitupkar89556 жыл бұрын
Nice and molodious.
@jasalbirthshira49005 жыл бұрын
What a voice too
@freedbird21455 жыл бұрын
But juhi got married old man..only for money
@queenofzee5 жыл бұрын
@@freedbird2145 SHE DID. MONEY TALKS. CLEARLY SHE IS HAPPY, THAT IS WHAT MADE HER HAPPY. THE OLD GUY IS STILL AROUND AND WILL BE FOR A LONG TIME TO COME :) IF SHE GOT MARRIED THINKING HE WILL BE GONE SOON - DID NOT HAPPEN - YOU LIVE ONCE i SAY - BUT THAT IS WHAT SHE CHOSE.
@nenkhery4 жыл бұрын
Abhijeet's voice was the most suitable voice for SRK I thought....
@alfarezelfatahillah10434 жыл бұрын
agree. . abhijeet voice also similar enough with shahrukhan real voice in the movie. that's make it so pure
I have seen many Hindi films. She's truly special. Like today, we need to combine Deepika, Soonam, and Katrina together on one screen to approach her Charisma. Like come on, what she doesn't have in her prime? Her beauty not just beautiful, but gorgeous, so charming and stunning. Her smile with that such intoxicating eyes enough to kill your love, she's sexy too, and don't ask about how great her acting. Such mind-blowingly women. Even Mr. Yash Chopra called her 'The Most Indian Beauty'. She has everything that women dream of. Big Respect!
@mujahidmd16545 жыл бұрын
Bhai itni tarref 😯😯 But jo kuch bi tumne likha wo ek dum sahi. hai. She looks Magical.
@junaidanwar9995 жыл бұрын
Absolutely true.
@rjnskmr654 жыл бұрын
Correct bro👍👍
@زينبعالمي-ذ1ع4 жыл бұрын
Beautiful words really expresses mam juhi beauty
@زينبعالمي-ذ1ع4 жыл бұрын
💓💓
@kh76886 жыл бұрын
Juhi and SRK have great chemistry together. They're both so sweet together.
@avikgope4156 Жыл бұрын
Juhi is natural beauty with out any cosmetic surgery.
@Shalinisingh-oj4ip7 жыл бұрын
Juhi chawla most beautiful woman on this planet n srk juhi made for each other n srk loves her so much in real n y not she is so beautiful so heavenly beautiful. Love u both so much
@annappabe59105 жыл бұрын
Shalini Singh was planning on it in the
@damayanti45985 жыл бұрын
Hushjtwhsulsh ÷¢÷`=Π`√°Π°°¢Π
@rifky77963 жыл бұрын
You're right
@pratyushsinha68234 жыл бұрын
I wish and pray... For 2 reunions 1. Shahrukh and Abhijeet 2. Jatin Lalit. (Together again) All four doing a movie together It will be dream come true for me.
@dipzdes24804 жыл бұрын
agree
@recipesunboxing55634 жыл бұрын
Juhi n Srk bhi
@antaradas18784 жыл бұрын
Same wish...
@AjaySharma-bh4vo4 жыл бұрын
ha yr .. Jatin lalit 14 sal se alag h yrr .. ab tk tak to hajaro behtareen gane ban chuke hote
@fluidmechanics87593 жыл бұрын
RD Burman da and Kishore da
@atieks96763 жыл бұрын
Love this couple Juhi Chawla and Shahrukh Khan 💞👍
@kanchanchoudhary28363 жыл бұрын
Choreography of this song is so beautiful Background,colour combination everything ❤
@ovijitbarua54513 жыл бұрын
I still hve hopes to see SRK and Abhijeet would reunite again! Its only SRK who can make this happen.....We miss you the both singing pairs of SRK and Abhijeet....... Plz Sir,Bring Abhijeet back to Ur voice again🙏
@bbmaths2824 ай бұрын
Wow just awesome..... close your eyes and you will enter an another world...
@bhumikadudhe82764 жыл бұрын
When a legend merges with Legend, a super legend is formed. This is the case with SRK and Abhijeetji. Hope to see them together again.
@saarcful4 жыл бұрын
Wowww, full of goosebumps & tears! It really brought my childhood back, one moment, I went to 1999 and back. It once again blossomed my old memories of teenage!
@fahimaahmed31884 жыл бұрын
❤👍
@pritiag7134 Жыл бұрын
So true.
@firdhaaulia78075 ай бұрын
They are the cutest!!!! 🫶🏻
@jaibheem32674 жыл бұрын
Kya aawaj hai yaar Ab kyo nhi aate iss tarhe ke singer's yaar 🥰🥰🥰🥰🥰🥰🥰
@azriekamachannel43175 жыл бұрын
2019...i like this song...namaste🇮🇳🙏🏿 from malaysia🇲🇾
@guddangupta56253 жыл бұрын
Jjgjjg
@kowsar32083 жыл бұрын
I'm 🇧🇩🇧🇩🇧🇩🥰🥰💪😎😎😎😍😍
@nishantgupta65752 ай бұрын
This songs takes u to your dream imagination with your soulmate another universe...what a calm song...uhh❤
@b.m.k76 жыл бұрын
SHAHRUKH+ JUHI. AUR KYA. One of my favourite Jodi. 😍😍😍❤❤❤ Evergreen SHAHRUKH ❤❤❤❤❤❤❤❤❤
@yesupillay67774 жыл бұрын
My favorite Jodi...
@sabihayasmin40814 жыл бұрын
Meri vhi favourite jodi...
@bestsongeversingh99954 жыл бұрын
Yeahhh that's true this couple looked great in the film Yes Boss also ☺️☺️😎😎😁😁😁
@kaushikdas474 жыл бұрын
My favorite jodi.
@mansichaudhari584 жыл бұрын
Me too
@golamsahaniyaz90656 жыл бұрын
Legendary Abhijeet makes the song beautiful. Such a outstanding singer.
@astd97293 ай бұрын
What a beautiful romantic composition by Jatin Lalit ji.They deserve really Padma Bhushan if you go through their compositions minutely you will say it tobe right
@tanialexa108 жыл бұрын
I looove Abhijeet and Alka, just perfect.
@sufailhamid56258 жыл бұрын
Sasha Talm Hi
@nurseh97587 жыл бұрын
Sasha Talm
@biplobkhan95337 жыл бұрын
Great song my life
@asifam7156 жыл бұрын
Hi madem
@Dinesh_Choudhary105 жыл бұрын
Superb👌👌👌🎤🎤😘
@krishnasingh34247 жыл бұрын
It's Top songs of ...90 SRK With Juchi..☺☺☺☺
@rajmun31136 жыл бұрын
Raju
@rajmun31136 жыл бұрын
Nic song
@Anjolina211Ай бұрын
I love this, please don’t ever delete. God bless you.
@amarsaha20056 жыл бұрын
I was 19 when I listened to it...After 20 yrs I am listening to it.feeling better.
@infinitynetwork56053 жыл бұрын
This movie and it's songs were way ahead of its time
@Varalakshmi1516Ай бұрын
Srk ❤ Juhi best couple 😊
@shwetagupta60464 жыл бұрын
Srk and juhi has more charming.... Screen couple.... Super talented both.... Kaam se hi Dhikhta hai
@muhammadnayeem38913 жыл бұрын
Juhi srk nice couple
@muhammadnayeem38913 жыл бұрын
Ap kaha se hai Shweta g
@RiteshBhanushali8 жыл бұрын
most romantic song of srk !
@rohanihashim97947 жыл бұрын
I love shk .
@kumariching46994 жыл бұрын
loveyou🎊🎊🎊🎊🎊🎊🎊
@aesthetic675002 жыл бұрын
🤗😊😁BACHPAN MEI MUJHE AISA LAGTA THA SRK AUR JUHI HI GAATE HAIN SONGS 😁. BILKUL PERFECT ❤ THIS IS ONE OF THE BEST SONGS and our generation is the last generation jo aaj v sunti hai ye songs🥺❤
@pawanvishkarma35354 жыл бұрын
I listened this song when I entered my first day of school in the year 2004.I was in school van and driver was listening this song .What a golden days they were 2000-2009 year.
@fahimaahmed31884 жыл бұрын
👍
@starthawani34563 жыл бұрын
❤️
@ifrahmehr60306 жыл бұрын
Favorite song since childhood.. Such a sweet couple Juhi and Sharukh make💞
@adi-alfalfa3 жыл бұрын
Unmatchable on-screen pair It just wahoooo...,,👌👌
@theaddictive76553 жыл бұрын
Ufffff what a great song 🔥🔥 killed it ond juhi crossed all limits of cuteness 😘😘
@Shalinisingh-oj4ip7 жыл бұрын
shahrukh n juhi r true soulmates no one can match their chemistry.
@AsifAli-ol4wk6 жыл бұрын
We want them back on screen!
@sunnymane56465 жыл бұрын
yess
@journey95far495 жыл бұрын
@@AsifAli-ol4wk Never going to happen, SRK only works with the younger actresses now. Juhi has been too "old" since the mid 2000's
@vijaypatil72694 жыл бұрын
Absolutely right
@MONUKHAN-bi8ml4 жыл бұрын
yes shalini
@avisingh70013 жыл бұрын
Beautiful song. Gave me goosebumps. SRK, Salman, Amir Khan got the best times. Late 90s early 2000s, these were magical times. Songs that made sense, simple and pure acting. Everything was natural. The Indian songs these days are such crap.
@tastymusic31764 жыл бұрын
The real king who was born with crown hidden but was exposed by nature. Finally he proved that he is the king of bollywood.
@aparajitadas37234 жыл бұрын
Shahrukh+ Juhi- "Shahi" jodi of bollywood...😍😘👍
@Kavita_1433 жыл бұрын
Woow Such a beautiful song , I Love ShahRukh ❤💖 aisa lag raha ye song SRK aur Juhi dono ne hi gaaya hai 🤩. I really love this song ,🧡 ShahRukh and Abhijeet Combination is world's best Combo. 🥰Beautiful Song❤💖
@Kavita_1432 жыл бұрын
❤❤❤❤ 17th Of July 2022 ❤❤❤❤ And Forever 😘❤🤩😍
@novishartikaompusunggu6908 Жыл бұрын
Juhi ❤
@sabrinayasminroshni32484 жыл бұрын
This man lost everything in young age family mom dad his sister got depression then started his career by Seriel Bollywood debut by other rejected movies he never give up life true inspiration shahrukh khan sir😞😭😭😭
@shakilkhan-xc9ub3 жыл бұрын
A tribute to Shahrukh Khan
@kimberlychako72692 жыл бұрын
We haven't seen SRK to be himself in movies in a long long time. That's cs he hasn't worked with Juhi in a while. Bring them back together now!!! no special appearance nonsense just on a full romantic movie
@hari24Hh2 ай бұрын
This song is just like Jannat❤❤❤
@softskillspathshala56443 жыл бұрын
Beautiful lyrics, silent soothing music, deadly combo SRK Juhi Abhijeet Alka Yagnik....jo ho dil mein kehdo... Aur kya. Refreshing Always 😀😀😀😀
@RohitKumar-pu2pb Жыл бұрын
Yeh gana solid no people empty Alley's streeets
@rupshasil58814 ай бұрын
That grey and red colour combination gown ❤️ Such an unique palette ✨
@thegolmei4 жыл бұрын
Such a beautiful song, lyrics, music n even the set...I still remember the lyrics..while playing antakshari whenever someone sing this song we used to sing together till the end...such was the magic of this song...loved it
@impiyushhh6 жыл бұрын
Srk Sir + Abhijeet Sir = Melodies !!..!!😍😍😘😘!!.!!
@adlinairianahashim72425 жыл бұрын
.rwuc a kw aovw howv wba .tw mvs8v wk w vwigwbo .gs ancywivw ca s afbcmvw Fa sts cv nwv ge bscbwb Ca afs ba snvwvtwy vvs wh
op to Ms Johnson I have a lot of work to so much for dinner tonight if c and I will be in town for a few mins and see how you GG and it was the same as end and the money was taken out for a good times with
@kishanverma7869 ай бұрын
0:34 ❤❤❤❤
@Emily-ez2pt4 жыл бұрын
One of the best song of srk... Looking so sweet srk