EVERYTHING Size Comparison 2021 (FULL) 3D 4K 60FPS

  Рет қаралды 270,875

Universe UA

Universe UA

Күн бұрын

Пікірлер: 635
@JoeystudiostheALT74
@JoeystudiostheALT74 Жыл бұрын
0:00 smallest stuff 6:16 quarks 9:17 nucleuses 12:00 atoms 32:58 molecules 35:06 micro world 44:17 everyday objects 48:18 tanks 53:43 trees and buildings 59:57 mountains,asteroids and moons 1:15:38 planets 1:33:49 stars 2:10:09 systems,black holes and nebulas 2:19:04 galaxy’s and clusters 2:28:00 beyond the universe
@extra...
@extra... Жыл бұрын
Noice
@eurybiaball63
@eurybiaball63 8 ай бұрын
When I click onto one of those Timestamps, i get bombarded with ads
@mariloubarawid8276
@mariloubarawid8276 4 ай бұрын
Hhhhhhhhhhhhhh7
@Spacelover179
@Spacelover179 4 ай бұрын
Kik​@@extra...
@S_repofgardenvill
@S_repofgardenvill 2 ай бұрын
Things I Spotted! 9:00 HIDDEN MICKEY 10:28 THERES TWO!??! BFDI x II animation 10:45 “and where’s the Venus nucleus?” 11:43 it’s a bird! It’s a plane! ITS SUPERMAN *1940s Superman music plays* 12:00 Ring around the Rosie’s! A pocket full of posies! Achoo! Achoo! We all fall down! 12:24 Wasp-12 B be like: 13:07 *insert goofy ahh gulping noises* 14:15 that I will lose if I hear one more BenjixScarlett song. 15:00 I never remembered mercury having moons. 15:13 “TENNESIUM, OGANESSON. AND. THEN. WE’RE. DOOOOONNNEEE.” - ASAP Science 16:14 Yukon, Alaska, California, Here I come!😊 19:54 “GOODBYE NAPOLEON”👺 - dumbledore said calmly 22:27 “where is the Teslinium atom?” 23:15 “ERM, ACTUALLY *sniff* THATS THE NICKEL ATOM” - 🤓 32:12 “….where is the Octavium atom?” 32:43 *see **13:07* 34:25 t h e d r o p p e r 36:03 “You are the few, the proud, you are the antibody, mind, soul, and zen.” - Smash Mouth End of part 1…….. part 2 at 100 likes.
@Mangoman-1z23
@Mangoman-1z23 10 ай бұрын
2:10:11 Vega System 2:10:20 Sirius System 2:10:39 M60 Black Hole 2:10:57 Holmblerg 15A B/H 2:11:15 Beta Pictoris System 2:11:31 S5 0014+81 2:11:49 TON 618 2:12:17 1 Light Year 2:12:35 The Oort Cloud 2:12:51 The Helix Nebula 2:13:08 The Pillars Of Creation 2:13:27 The Flame Nebula 2:13:33 Pleiades Cluster 2:14:00 Beehive Cluster 2:14:19 Cave Nebula 2:14:34 Veil Nebula 2:14:54 47 Tucaenae 2:15:12 M60 UCD1 2:15:28 Messier 3 2:15:45 Omega Centauri 2:16:03 Palomar 12 2:16:20 RCW 49 2:16:37 Carina Nebula 2:16:56 Small Sagittarius Star Cloud 2:17:14 30 Dorarus 2:17:35 Gum Nebula 2:17:48 Circinus Galaxy 2:18:05 Gould Belt 2:18:25 Small Magellanic Cloud 2:18:40 Large Magellanic Cloud 2:18:59 Sombrero Galaxy 2:19:21 Triangulum Galaxy 2:19:33 Whirpool Galaxy 2:19:57 Hoag's Object 2:20:12 Cartwheel 2:20:27 Milky Way 2:20:42 Pinwheel Galaxy 2:21:00 Andromeda Galaxy 2:21:22 Tadpole Galaxy 2:21:35 Condor Galaxy 2:21:58 Malin 1 2:22:11 Caldwell 35 2:22:34 NGC 4921 2:22:45 IC1101 2:23:05 Abell 2029 2:23:20 Local Group 2:23:44 Hydra Cluster 2:24:03 Centarus Cluster 2:24:15 Virgo Cluster 2:24:30 SCL@1338+2 2:24:48 Phoenix Cluster 2:25:06 Virgo Supercluster 2:25:31 Hercules Supercluster 2:25:47 Hydra Centarus Supercluster 2:26:00 Ursa Major Supercluster 2:26:22 Great Attractor 2:26:32 Laniakea 2:26:57 Pisces Cetus Supercluster Complex 2:27:12 Sloan Great wall 2:27:27 Huge LQG 2:27:43 Hercules Corona Borealis 2:28:07 Observable universe 2:28:10 Universe 2:28:16 Imaginary tetrahedron 2:28:22 Imaginary dodecahedron 2:28:29 Imaginary Hexahedron 2:28:37 Imaginary Icosidodecahedron 2:28:44 larger universe 2:28:51 Mandelbrot Zoom 2:29:03 Yoctoverse 2:29:04 Multiverse 2:29:12 metaverse 2:29:19 megaverse 2:29:26 Gigaverse 2:29:33 Teraverse 2:29:43 Exaverse 2:29:48 L Verse 2:29:54 Xenoverse 2:30:02 Hyperverse 2:30:09 Omniverse 2:30:15 The Outside 2:30:21 Barrel 2:30:29 The box 2:30:36 Infinity 2:30:43 Transfinity 2:30:49 Outro
@oleseavascan369
@oleseavascan369 7 ай бұрын
WHAT
@JohnKamauNjenga
@JohnKamauNjenga 2 жыл бұрын
Awesome. I even love the fact that you don't go into all those verbal explanations that can sometimes be boring with unnecessary stories. You just provide facts and let the audience read and watch the size comparison. From an INFJ in Nairobi.... THANK YOU!!!
@Mangoman-1z23
@Mangoman-1z23 Жыл бұрын
2:28:07 the observable universe 2:28:09 The universe 2:28:16 The Imaginary tetrahedron 2:28:22 The Imaginary dodecahedron 2:28:29 The Imaginary Hexahedron 2:28:36 The Imaginary Icosidodecahedron 2:28:44 The larger universe 2:28:51 The mandelbrot zoom 2:28:57 The Yoctoverse 2:29:05 The multiverse 2:29:12 The metaverse 2:29:19 the megaverse 2:29:26 The gigaverse 2:29:33 the Teraverse 2:29:40 The exaverse 2:29:47 The L-Verse 2:29:53 The Xenoverse 2:30:01 The Hyperverse 2:30:08 the Omniverse 2:30:15 The outside 2:30:22 The barrel 2:30:29 The box 2:30:36 The infinity 2:30:43 The Transinfinity
@Octoevanos
@Octoevanos Жыл бұрын
0:00:17 Protoverse 0:00:34 Planck Length 0:00:46 Graviton 0:01:02 Tau Neutrino 0:01:16 String 0:01:30 Brane 0:01:44 Anti-proton 0:01:57 Anti-neutron 0:02:12 X-boson 0:02:26 Muon Neutrino 0:02:41 Y-boson 0:02:53 Electron Neutrino 0:03:03 Fermion 0:03:23 Tachyon 0:03:36 Calabi Yau Manifold 0:03:50 Quantum Foam 0:04:04 Muon 0:04:19 Planck Particle 0:04:33 Yoctometer 0:04:46 1 MeV Neutrino 0:05:04 Top Quark 0:05:18 Preon 0:05:32 Zeptometer 0:05:46 High Energy Neutrino 0:06:09 Bottom Quark 0:06:22 Charm Quark 0:06:36 Strange Quark 0:06:50 Attometer 0:07:04 Up Quark 0:07:18 Down Quark 0:07:32 Electron 0:07:46 Weak Force 0:08:04 Femtometer 0:08:18 Neutron 0:08:32 Proton 0:08:45 Hydrogen Nucleus 0:09:00 Tritinium Nucleus 0:09:14 Helium Nucleus 0:09:28 Lithium Nucleus 0:09:42 Oxygen Nucleus 0:09:56 Neon Nucleus 0:10:10 Chlorine Nucleus 0:10:24 Nickel Nucleus 0:10:38 Mercury Nucleus 0:10:52 Uranium Nucleus 0:11:06 Ununoctium Nucleus 0:11:25 Picometer 0:11:39 X-ray Wavelength 0:11:53 Sulfur Atom 0:12:07 Silicon Atom 0:12:21 Hydrogen Atom 0:12:38 Iron Atom 0:12:49 Ammonia Molecule 0:13:03 Water Molecule 0:13:17 Zinc Atom 0:13:31 Helium Atom 0:13:45 Copper Atom 0:13:59 Fluorine Atom 0:14:13 Oxygen Atom 0:14:27 Neon Atom 0:14:41 Nitrogen Atom 0:14:54 Mercury Atom 0:15:09 Oganesson Atom 0:15:23 Cadmium Atom 0:15:37 Flerovium Atom 0:15:51 Tennesine Atom 0:16:06 Gold Atom 0:16:19 Silver Atom 0:16:33 Palladium Atom 0:16:47 Carbon Atom 0:17:01 Magnesium Atom 0:17:15 Rhodium Atom 0:17:29 Chlorine Atom 0:17:43 Platinum Atom 0:17:57 Ruthenium Atom 0:18:11 Boron Atom 0:18:25 Iridium Atom 0:18:39 Nihonium Atom 0:18:53 Lithium Atom 0:19:07 Technetium Atom 0:19:21 Livermonium Atom 0:19:36 Aluminium Atom 0:19:49 Arsenic Atom 0:20:04 Bromine Atom 0:20:18 Zirconium Atom 0:20:31 Gallium Atom 0:20:46 Argon Atom 0:21:00 Beryllium Atom 0:21:14 Selenium Atom 0:21:28 Phosphorus Atom 0:21:42 Molybdenum Atom 0:21:56 Radon Atom 0:22:09 Fermium Atom 0:22:24 Einsteinium Atom 0:22:38 Plutonium Atom 0:22:52 Californium Atom 0:23:07 Nickel Atom 0:23:20 Osmium Atom 0:23:34 Neptunium Atom 0:23:49 Cobalt Atom 0:24:08 Krypton Atom 0:24:23 Lead Atom 0:24:39 Rhenium Atom 0:24:54 Vanadium Atom 0:25:10 Manganese Atom 0:25:26 Antimony Atom 0:25:41 Germanium atom 0:25:57 Niobium Atom 0:26:12 Titanium Atom 0:26:28 Xenon Atom 0:26:43 Copernicium Atom 0:26:59 Tantalum Atom 0:27:15 Indium Atom 0:27:30 Thallium Atom 0:27:46 Hafnium Atom 0:28:01 Tin Atom 0:28:16 Sodium Atom 0:28:32 Neodymium Atom 0:28:48 Scandium Atom 0:29:03 Bismuth Atom 0:29:18 Calcium Atom 0:29:34 Thorium Atom 0:29:50 Promethium Atom 0:30:06 Praseodymium Atom 0:30:21 Iodine Atom 0:30:37 Cerium Atom 0:30:52 Barium Atom 0:31:08 Potassium Atom 0:31:23 Radium Atom 0:31:39 Rubidium Atom 0:31:55 Uranium Atom 0:32:10 Caesium Atom 0:32:26 Francium Atom 0:32:41 Alcohol Molecule 0:32:57 Ethanol Molecule 0:33:12 Adenine Molecule 0:33:28 Nanometer 0:33:48 Buckyball Molecule 0:34:06 Adenosine Molecule 0:34:23 Carbon Molecule 0:34:41 Glucose Molecule 0:34:58 DNA String 0:35:16 Phospholipid Bilayer 0:35:33 Hemoglobin 0:35:51 Antibody 0:36:08 Bacteriophage 0:36:25 Ultraviolet Light W/L 0:36:43 Violet Light Wavelength 0:37:01 Purple Light Wavelength 0:37:17 Blue Light Wavelength 0:37:36 Cyan Light Wavelength 0:37:52 Green Light Wavelength 0:38:10 Yellow Light Wavelength 0:38:28 Orange Light W/L 0:38:45 Red Light Wavelength 0:39:04 Infrared Light W/L 0:39:21 Micrometer 0:39:38 Lysosome 0:39:56 Y Chromosome 0:40:13 E. Coli 0:40:31 X Chromosome 0:40:48 Red Blood Cell 0:41:06 Chloroplast 0:41:23 White Blood Cell 0:41:41 Pollen 0:41:58 Thiomargarita Namibiensis 0:42:16 Amoeba 0:42:34 Grain Of Salt 0:42:51 Grain Of Sand 0:43:08 Millimeter 0:43:32 Snow Crystal 0:43:49 Centimeter 0:44:07 Coffee Bean 0:44:24 Tennis Ball 0:44:42 Fox Terrier 0:45:03 Meter 0:45:16 AGM-114 HellFire 0:45:35 Human 0:45:52 AGM-65 0:46:09 R73 0:46:27 AIM-120D 0:46:44 MBDA Meteor 0:47:02 Japanese Spider Crab 0:47:20 Apple Tree 0:47:35 R27 0:47:54 SM-2 0:48:12 Pz. II 0:48:30 Pz. III 0:48:47 Common Box 0:49:04 BGM-109 Tomahawk 0:49:22 M4 0:49:39 Pz. IV 0:49:57 T-34 0:50:14 T-34-85 0:50:31 Su-85 0:50:49 Su-100 0:51:07 Tiger I 0:51:25 T-62 0:51:42 KV-1 0:51:59 KV-2 0:52:16 IS-3 0:52:34 Panther I 0:52:52 Tiger II 0:53:10 Leopard 2A6 0:53:27 M1 Abrams 0:53:45 Dragon Tree 0:54:02 Salix Babylonica 0:54:19 Stone Pine 0:54:36 Ash Tree 0:54:55 Palm Tree 0:55:21 Baobab 0:55:29 Blue Whale 0:55:47 Sycamore 0:56:04 P. 1000 Ratte 0:56:22 Conker Tree 0:56:39 Oak 0:56:57 Brazil Nut Tree 0:57:15 Eucalyptus 0:57:32 Fir Tree Noble 0:57:50 ISS 0:58:07 Hyperion Sequoia 0:58:25 Oumuamua 0:58:42 Titanic 0:59:02 Burj Khalifa 0:59:19 Angel Falls 0:59:37 Kilometer 0:59:56 Mt. Meron 1:00:13 Aegaeon 1:00:31 Methone 1:00:48 PSR B0943+10 1:01:06 Mt. Kilimanjaro 1:01:23 Mt. Everest 1:01:41 Maxwell Montes 1:01:59 Mariana Trench 1:02:16 Deimos 1:02:34 Halley's Comet 1:02:51 PSR J0348+043 1:03:09 Lich Pulsar 1:03:26 Crab Pulsar 1:03:44 Olympus Mons 1:04:01 Phobos 1:04:18 PSR B1919+21 1:04:36 PSR J0437-4715 1:04:53 PSR B1957+20 1:05:11 PSR J1719-1438 1:05:28 PSR J2144-3933 1:05:46 PSR B1937+21 1:06:03 Pan 1:06:20 PSR J1311-3430 1:06:39 PSR J1748-2446AD 1:06:56 Eros 1:07:14 XTE JI650-500 1:07:31 Cygnus X-1 1:07:49 Epimethus 1:08:06 Chiron 1:08:24 Hyperion 1:08:41 Nix 1:08:58 Chariklo 1:09:16 Hi‘iaka 1:09:33 Mimas 1:09:51 Enceladus 1:10:08 Vesta 1:10:26 Ixion 1:10:43 Dysnomia 1:11:01 Quaoar 1:11:18 Ceres 1:11:36 Umbriel 1:11:54 Dione 1:12:11 Ariel 1:12:28 Charon 1:12:46 Iapetus 1:13:03 Makemake 1:13:21 Oberon 1:13:38 Titania 1:13:56 Haumea 1:14:13 Eris 1:14:31 Pluto 1:14:49 Triton 1:15:06 Europa 1:15:23 The Moon 1:15:41 Io 1:15:59 Kepler-37b 1:16:16 Kepler-444b 1:16:34 Callisto 1:16:51 Mercury 1:17:09 Titan 1:17:26 Ganymede 1:17:44 Kepler-444c 1:18:01 Kepler-62c 1:18:18 Kepler-444d 1:18:36 Mars 1:18:53 A.C.+70*8247 1:19:11 IK Pegasi B 1:19:29 Trappist-1h 1:19:56 Sirius B 1:20:14 TRAPPIST-1e 1:20:31 Venus 1:20:49 The Earth 1:21:06 TRAPPIST-1f 1:21:24 TRAPPIST-1c 1:21:41 TRAPPIST-1b 1:22:00 Proxima B 1:22:16 Trappist-1g 1:22:34 HLX-1 1:22:52 Van Maanen's Star 1:23:10 Kepler-62f 1:23:26 Kapteyn B 1:23:44 Kepler-10b 1:24:01 Kepler-366b 1:24:18 40 Eridani B 1:24:36 Gliese-667Cc 1:24:54 COROT-7b 1:25:11 Gliese-876d 1:25:29 Kepler-62e 1:25:46 Kepler-69c 1:26:04 Gliese-667Cf 1:26:21 Gliese-667Ce 1:26:39 KOI-1781b 1:26:57 WASP-47c 1:27:13 Wolf 503b 1:27:31 Kepler-22b 1:27:49 Gliese-667Cg 1:28:07 Procyon B 1:28:24 Epsilon Eridani B 1:28:49 Planet Nine 1:28:59 Neptune 1:29:16 Kepler-1625b b 1:29:34 Uranus 1:29:51 Gliese-667Cd 1:30:09 Gliese-667Cb 1:30:27 Kepler-669b 1:30:44 Epsilon Eridani c 1:31:01 Kepler-51b 1:31:23 Pollux b 1:31:41 Kepler-16b 1:31:59 Teide 1 1:32:16 Epsilon Indi BA 1:32:33 SWEEPS-04 1:32:51 Saturn 1:33:08 EBLM J0555-57AB 1:33:25 Jupiter 1:33:43 DX Cancri 1:34:01 SIMP J013656.5+0933473 1:34:18 47 Ursau Majoris b 1:34:35 OGLE-TR-122b 1:34:53 TRAPPIST-1 1:35:11 Fomalhaut b 1:35:28 Teegarden's Star 1:35:46 TRES-2b 1:36:04 Luyten 726-8 A 1:36:21 Proxima Centauri 1:36:38 51 Pegasi b 1:36:56 Beta Pictoris B 1:37:14 Ross 248 1:37:31 YZ Ceti 1:37:49 Wolf 424 A 1:38:06 WASP-17b 1:38:23 Groombridge 34 B 1:38:41 Barnard's Star 1:38:59 HAT-P-32b 1:39:16 Upsilon Andromedae B 1:39:34 CT Chamaeleontis 1:39:51 Ross 154 1:40:09 Gliese 1 1:40:26 Kruger 60 B 1:40:44 Kapteyn's Star 1:41:01 40 Eridani C 1:41:19 Luyten's Star 1:41:36 Kruger 60 A 1:41:53 Gliese-876d 1:42:11 Groombridge 34 A 1:42:28 Lalande 21185 1:42:46 Gliese-667 C 1:43:03 AT Microscopii A 1:43:21 HD 100546 B 1:43:39 Gliese-667 B 1:44:01 Epsilon Indi A 1:44:18 Kepler-70 System 1:44:36 Epsilon Eridani 1:44:53 Alpha Centauri B 1:45:11 The Sun 1:45:29 WASP-47 1:45:46 Alpha Centauri A 1:46:04 Sirius A 1:46:21 IK Pegasi A36 1:46:39 Kepler-36 1:46:56 Altair 1:47:14 Kepler-42 System 1:47:31 Algol Ab 1:47:48 Fomalhaut 1:48:06 Procyon 1:48:24 Beta Piscis Austrini A 1:48:41 Epsilon Boötes B 1:48:59 Algol Aa1 1:49:16 Vega 1:49:33 Algol Aa2 1:49:51 Regulus 1:50:09 Bellatrix 1:50:26 V404 Cygni B 1:50:43 Beta Lyrae Aa2 1:51:01 Gamma Velorum WR 1:51:19 Pollux 1:51:36 VV Cephei B 1:51:53 COROT-7 System 1:52:11 Kepler-444 System 1:52:29 Omicron Persei Ab 1:52:46 Omicron Persei Aa 1:53:03 Achernar 1:53:21 Kepler-49 System 1:53:38 Kepler-19 System 1:53:56 Kepler-36 System 1:54:14 Kepler-32 System 1:54:31 Kepler-223 System 1:54:48 Beta Lyrae Aa1 1:55:06 Gamma Velorum O 1:55:23 Zetta Puppis 1:55:41 Kepler-9 System 1:55:59 Arcturus 1:56:16 Kepler-10 System 1:56:33 Kepler-37 System 1:56:51 Kepler-33 System 1:57:08 R136A1 1:57:26 Saggitarius A* 1:57:44 Epsilon Boötes A 1:58:01 Kepler-436 System 1:58:19 Polaris 1:58:36 Kepler-20 System 1:58:54 Kepler-186 System 1:59:11 Kepler-62 System 1:59:28 Aldebaran 1:59:46 Kepler-11 System 2:00:03 Gliese-667 System 2:00:21 Kepler-69 System 2:00:38 Alpha-Percei 2:00:56 Canopus 2:01:19 Kepler-16 System 2:01:38 Rigel 2:01:55 Gamma Andromedae A 2:02:12 VFTS 102 2:02:29 Gacrux 2:02:47 WASP-47 System 2:03:05 Deneb 2:03:22 S Doradus 2:03:39 Pi Puppis 2:03:57 Pistol Star 2:04:14 Gliese-892 System 2:04:32 La Superba 2:04:49 IRC+10420 2:05:07 R Doradus 2:05:24 Eta Carinae A 2:05:41 Gliese-581 System 2:06:00 VV Cephei A 2:06:17 119 Tauri 2:06:34 55 Cancri System 2:06:52 Antares 2:07:09 Mu Cephei 2:07:27 Betelgeuse 2:07:45 HR 5171 2:08:02 VY Canis Majoris 2:08:20 UY Scuti 2:08:37 Stephenson 2-18 2:08:55 Fomalhaut System 2:09:11 Outer Solar System 2:09:29 Kuiper Belt 2:09:47 Quasi Star 2:10:04 Vega System 2:10:22 Sirius System 2:10:39 Messier 60 2:10:57 Holmberg 15A B/H 2:11:14 Beta Pictoris System 2:11:32 S5 0014+81 2:11:50 TON 618 2:12:12 Light Year 2:12:34 Oort Cloud 2:12:52 Helix Nebula 2:13:09 Pillars Of Creation 2:13:27 Flame Nebula 2:13:44 Pleiades Cluster 2:14:02 Beehive Cluster 2:14:20 Cave Nebula 2:14:37 Veil Nebula 2:14:54 47 Tucanae 2:15:12 M60-UCD1 2:15:30 Messier 3 2:15:47 Omega Centauri 2:16:04 Palomar 12 2:16:22 RCW 49 2:16:39 Carina Nebula 2:16:57 Small Saggitarius Star Cloud MAXIMUM LETTERS
@soso-dv9ny
@soso-dv9ny Жыл бұрын
Wow. That took you a very long time to do all of that!
@Рсрльие
@Рсрльие Жыл бұрын
Gould Belt
@lizdp3893
@lizdp3893 Жыл бұрын
How just how
@КсенияНемкова-п9э
@КсенияНемкова-п9э 11 ай бұрын
UY Scuti
@КсенияНемкова-п9э
@КсенияНемкова-п9э 11 ай бұрын
Stephenson 2-18
@leshagamer2024
@leshagamer2024 3 ай бұрын
EVERYTHING Size Comparison 2021 (FULL) 3D 4K 60FPS Timelapse: 0:00 Smallest Stuff 6:16 Quarks 9:17 Nucleuses 12:00 Atoms 32:58 Molecules 35:06 Micro World 44:17 Everyday Objects 48:18 Tanks 53:43 Trees And Buildings 59:57 Mountains, Asteroids And Moons 1:15:38 Planets 1:33:49 Stars 2:10:09 Systems, Black Holes And Nebulas 2:19:04 Galaxy’s And Clusters 2:28:00 Beyond The Universe All Parts: Part 1: 0:12 Part 2: 11:20 Part 3: 24:03 Part 4: 33:43 Part 5: 43:26 Part 6: 59:50 Part 7: 1:19:50 Part 8: 1:31:17 Part 9: 1:43:56 Part 10: 2:01:14 Part 11: 2:12:29 Watch other parts of the Size Comparison 2021! Part 1: kzbin.info/www/bejne/sGTRaYirbLiNeLM Part 2: kzbin.info/www/bejne/Y2HdhJ2Gq9N9rtE Part 3: kzbin.info/www/bejne/eXS1YaJ5r8iIqc0 Part 4: kzbin.info/www/bejne/n6TIooaJl62Mes0 Part 5: kzbin.info/www/bejne/n6DLgqOBjbh8rqs Part 6: kzbin.info/www/bejne/mpyZeIqjm6yhn9k Part 7: kzbin.info/www/bejne/pnfZdI2bpJKii6c Part 8: kzbin.info/www/bejne/iqS5lGeCqdKchZo Part 9: kzbin.info/www/bejne/bZ29latjqtCFoLs Part 10: kzbin.info/www/bejne/jGirgmCBrMmCoJI Part 11: kzbin.info/www/bejne/p3KUmHmOiKaFnpo Full version: kzbin.info/www/bejne/Z4upf6CJrtaBms0si=otWUkuFvxYPN_R4q
@Octoevanos
@Octoevanos 8 ай бұрын
Verses 2:28:07 - Observable Universe 93 billion light-years 2:28:08 - Universe 150 billion light years 2:28:16 - Imaginary Tetrahedron 1.48 trillion lightyears 2:28:23 Imaginary Dodecahedron 5.27 trillion lightyears 2:28:29 Imaginary Hexahedron 13.48 trillion lightyears 2:28:36 - Imaginary Icosidodecahedron 32.47 trillion lightyears 2:28:43 - Large Universe 148.27 trillion lightyears 2:28:51 - Mandelbrot Zoom 481.36 trillion lightyears 2:28:57 - Large Yoctoverse 824.27 trillion lightyears 2:29:05 - Multiverse 1.3 quadrillion lightyears 2:29:13 - Metaverse 5.28 quadrillion lightyears 2:29:19 - Megaverse 9.17 quadrillion light-yearz 2:29:25 - Gigaverse 62.36 quadrillion lightyears 2:29:33 - Teraverse 158.28 quadrillion lightyears 2:29:39 - Exaverse 964.28 quadrillion lightyears 2:29:47 - I-verse 9.27 quintillion lightyears 2:29:54 - Xenoverse 23.36 quintillion lightyears 2:30:00 - Hyperverse 94.27 quintillion lightyears 2:30:07 - Omniverse 6.28 decillion lightyears 2:30:15 - The Outside 8.26 novemdecillion lightyears 2:30:21 - Barrel 9.47 quattuorvigintillion lightyears 2:30:28 - The box 9.42 sextrigintillion lightyears 2:30:35 - Infinity 1.2 septuagintacentillion lightyears 2:30:43 - Transinfinity 6.2 quattuorsexagintaducentillion lightyears ?:??:?? - Mega-infinity 8.2 trucentillion lightyears ?:??:?? - Megafinity 41.2 quinquagintatrucentillion lightyears
@AlexsandarGaming_001
@AlexsandarGaming_001 2 жыл бұрын
Part 1: 0:12 Part 2: 11:21 Part 3: 24:03 Part 4: 33:43 Part 5: 43:27 Part 6: 59:50 Part 7: 1:19:51 Part 8: 1:31:18 Part 9: 1:43:56 Part 10: 2:01:14 Part 11: 2:12:29
@andysshitpostchannel6596
@andysshitpostchannel6596 2 жыл бұрын
That'll be fun to see these stars in the milky the same thing about it doesn't matter how many times can you take the time off boosters when texts about abilities are going here right now but everyone is going here right even though the weather is the weirdest dream about a car quick to eat and get back with another
@junebugrobotics
@junebugrobotics 2 жыл бұрын
Part 12 My Version 2:15:27
@AlexsandarGaming_001
@AlexsandarGaming_001 2 жыл бұрын
@@andysshitpostchannel6596 F___ Y__
@noobieplayzandanimates
@noobieplayzandanimates 2 жыл бұрын
How does this dude only have 14.4K Subscribers? He’s made videos for 5 years! Like, how come he has 14.4K? This dude deserves more, Especially because he made a 2 hour 30 minute video, in less than 1 year! This is amazing, he made 13 parts into this, and those parts took less than a year, I’m impressed by how fast he made this, I wish you go far Universe UA. Also, here are the atoms in order. 1. Hydrogen: 12:21 2. Helium: 13:31 3. Lithium: 18:53 4. Beryllium: 21:00 5. Boron: 18:11 6. Carbon: 16:47 7. Nitrogen: 14:41 8. Oxygen: 14:13 9. Fluorine: 13:59 10. Neon: 14:27 11. Sodium: 28:16 12. Magnesium: 17:01 13. Aluminum: 19:36 14. Silicon: 12:07 15. Phosphorus: 21:28 16. Sulfur: 11:53 17. Chlorine: 17:29 18. Argon: 20:46 19. Potassium: 31:07 20. Calcium: 29:19 21. Scandium: 28:47 22. Titanium: 26:12 23. Vanadium: 24:54 25. Manganese: 25:10 26. Iron: 12:35 27. Cobalt: 23:48 28. Nickel: 23:06 29. Copper: 13:48 30. Zinc: 13:17 31. Gallium: 20:32 32. Germanium: 25:41 33. Arsenic: 19:50 34. Selenium: 21:14 35. Bromine: 20:04 36. Krypton: 24:08 37. Rubidium: 31:39 40. Zirconium: 20:18 41. Niobium: 25:57 42. Molybdenum: 21:42 43. Technetium: 19:07 44. Ruthenium: 17:57 45. Rhodium: 17:15 46. Palladium: 16:33 47. Silver: 16:19 48. Cadmium: 15:23 49. Indium: 27:14 50. Tin: 28:01 51. Antimony: 25:25 53. Iodine: 30:21 54. Xenon: 26:27 55. Caesium: 32:10 56: Barium: 30:52 58. Cerium: 30:36 59. Praseodymium: 30:05 60. Neodymium: 28:32 61. Promethium: 29:50 72. Hafnium: 27:45 73. Tantalum: 26:59 75. Rhenium: 24:39 76. Osmium: 23:20 77. Iridium: 18:25 78. Platinum: 17:43 79. Gold: 16:05 80. Mercury: 14:55 81. Thallium: 27:30 82. Lead: 24:23 83. Bismuth: 29:03 86. Radon: 21:56 87. Francium: 32:25 88. Radium: 31:23 90. Thorium: 29:34 92. Uranium: 31:54 93. Neptunium: 23:34 94. Plutonium: 22:38 98. Californium: 22:52 99. Einsteinium: 22:24 100. Fermium: 22:10 112. Copernicium: 26:43 113. Nihonium/Ununtrium: 18:39 114. Flerovium/Ununquadium: 15:37 116. Livermorium/Ununhexium: 19:22 117. Tennesine/Ununseptium: 15:51 118. Oganesson/Ununoctium: 15:18 Also, here’s a pulsar part. 1:05:27.
@UniverseUA
@UniverseUA 2 жыл бұрын
Thanks. Really is often disappointing
@stanisdeadprobably
@stanisdeadprobably 2 жыл бұрын
and instead if showing good youtubers like this youtube rather shows sniperwolf and co
@Mangoman-1z23
@Mangoman-1z23 2 жыл бұрын
Bro You have So much replies
@CadetGriffin
@CadetGriffin 2 жыл бұрын
@@UniverseUA Do you remember the title of the soundtrack that begins at 26:45?
@ailiecooper3969
@ailiecooper3969 Жыл бұрын
@@UniverseUA😊
@leshagamer2024
@leshagamer2024 3 ай бұрын
Mistakes in Everything Size Comparison 2021 Mistakes in Part 1: Planck Length is come before Graviton should come after Planck Particle Yoctometer is 1E-24 Zeptometer is 1E-21 Attometer is 1E-18 Femtometer is 1E-15 Mistakes in Part 2: Picometer is 1E-12 Wrong spell on Nickel atom Mistake in Part 3: Nanometer is 1E-9 Mistakes in Part 9: Alpha Centauri B Size is mistake should be: 1,211,280km Procyon Size is mistake should be: 2,716,873km Mistakes in Part 10: Outer Solar System Size is mistake should be: 12,132,650,000km Outer Solar System,Kuiper Belt is come before Quasi Star should come after Vega System Mistakes in Part 11: RCW 49 unit is mistake should be: 350 LY NGC 4889 size is mistake should be: 1,000,000 LY
@salmapathan3322-h5p
@salmapathan3322-h5p 3 ай бұрын
Mistakes in EVERYTHING Size Comparison 2021 Planck Length is come before Graviton should come after Planck Particle Yoctometer is 1E-24 not 1E-21 Zeptometer is 1E-21 not 1E-18 Attometer is 1E-18 not 1E-15 Femtometer is 1E-15 not 1E-12 Picometer is 1E-12 not 1E-9 Wrong spell on N(i)ckel atom not Nckel atom Nanometer is 1E-9 not 1E-12 Alpha Centauri B Size is mistake should be: (1,2)11,280 km not 111,280 km Procyon Size is mistake should be: (2,71)6,873 km not 176,873 km Outer Solar System Size is mistake should be: 12,132,650(,000) km not 12,132,650 km Outer Solar System,Kuiper Belt is come before Quasi Star should come after Vega System RCW 49 unit is mistake should be: 350 LY not 350 LYm NGC 4889 size is mistake should be: 1,000,00(0) LY not 1,000,00 LY
@airbus_A380-h7u
@airbus_A380-h7u 2 жыл бұрын
0:10 Part 1 11:21 Part 2 24:03 Part 3 33:42 Part 4 43:26 Part 5 59:49 Part 6 1:19:50 Part 7 1:31:18 Part 8 1:43:56 Part 9 2:01:14 Part 10 2:12:29 Part 11
@raffeld.afrinaldi8911
@raffeld.afrinaldi8911 2 жыл бұрын
44:21 music - music is made marble mania
@raffeld.afrinaldi8911
@raffeld.afrinaldi8911 2 жыл бұрын
153:23:44
@raffeld.afrinaldi8911
@raffeld.afrinaldi8911 2 жыл бұрын
5622517726262564145435667617655378163534628735341763413642284867355422882873863763652542787847746763635543553553653667363878373877366353653653553553656367367367366553453443243143424525625636736837837763753653545344234329999887878789789789898899809909900990909898789877877876877676776765765665555556576667677667778778:12:33 PART 24.912TRGMUC
@raffeld.afrinaldi8911
@raffeld.afrinaldi8911 2 жыл бұрын
shyystsfstffstrwtrfwtfsftfaftrafrqdrqddsctfsvftstsarddrad
@raffeld.afrinaldi8911
@raffeld.afrinaldi8911 2 жыл бұрын
58:35 OUMUAMUA IS LEFT
@MC-ly4pm
@MC-ly4pm 3 жыл бұрын
Absolutely fascinating, I've been waiting for it sooooo long!!! Great Ta!!!
@seaweedandseafood2197
@seaweedandseafood2197 3 жыл бұрын
Fact: there is a Possible Tool. Planck length to penny. It needs like 90000 universes In a 2d world. I do not like to Caculate THE MUCH
@rikingking02
@rikingking02 4 ай бұрын
0:19 protoverse 0:37 planck length 1:02 tau neutrino 1:16 title string 1:57 anti-neutron 2:15 x-boson
@AlexsandarGaming_001
@AlexsandarGaming_001 2 жыл бұрын
Mistakes in Part 1: Planck Length is come before Graviton should come after Planck Particle Yoctometer is 1E-24 Zeptometer is 1E-21 Attometer is 1E-18 Femtometer 1E-15 Mistakes in Part 2: Picometer is 1E-12 Wrong spell on Nickel atom Mistake in Part 3: Nanometer is 1E-9 Mistakes in Part 9: Alpha Centauri B Size is mistake should be: 1 211 280 km Procyon Size is mistake should be: 2 716 873 km Mistakes in Part 10: Outer Solar System Size is mistake should be: 12 132 650 000 km Outer Solar System,Kuiper Belt is come before Quasi Star should come after Vega System Mistakes in Part 11: RCW 49 unit is mistake should be: 350 LY NGC 4889 Size is mistake should be: 1 000 000 LY
@andysshitpostchannel6596
@andysshitpostchannel6596 2 жыл бұрын
That'll be fun to see these stars in the milky the same thing about it doesn't matter how many times can you take the time off boosters when texts about abilities are going here right now but everyone is going here right even though the weather is the weirdest dream about a car quick to eat and get back with another
@SLS-StudioLoveSpace
@SLS-StudioLoveSpace 2 жыл бұрын
I also noticed this error (in 1 part)
@howardmunro5464
@howardmunro5464 2 жыл бұрын
A lighthearted is approximately 9,400,312,654,400 KM
@jobie_robloxia
@jobie_robloxia 5 ай бұрын
I don't get the first one
@myhamsterisbad
@myhamsterisbad 2 жыл бұрын
Part 1: 0:00-11:06 Part 2-11:06-24:00 Part 3- 24:00-33:44 Part 4 33:44-43:08 Part 5 43:08-59:52 Part 6 59:52-1:19:51 Part 7 1:19:51-1:31:18 Part 8 1:31:18-1:43:55 Part 9 1:43:55- 2:01:21 Part 10 2:01:21 - 2:12:17 Part 11 2:12:17 - 2:31:13
@TheVideosAreGood63
@TheVideosAreGood63 Жыл бұрын
Created by presents... Universe Size Comparison!!! Make sure like and subcribe! Ready? Go!
@TheVideosAreGood63
@TheVideosAreGood63 Жыл бұрын
Start Pronational 0:01
@TheVideosAreGood63
@TheVideosAreGood63 Жыл бұрын
Beginning 0:34
@TheVideosAreGood63
@TheVideosAreGood63 Жыл бұрын
Expanding more massless 1:31
@TheVideosAreGood63
@TheVideosAreGood63 Жыл бұрын
Even Really really Small 2:31
@Planet_139
@Planet_139 3 ай бұрын
7 Particle 9 Quarks 13 Nulucus 390 Atom 40 Molecule 20 Cell 90 animal humans 89 Astoroid 60 Dwarf planet and moons 100 Planet 300 Star 45 Black Hole and nebula 9 Galaxy 34 Cluster 11 Infinity and Verse 56 Exoplanet
@3r1ccsgo74
@3r1ccsgo74 3 жыл бұрын
wow thats excelent job, could you teach me to do that? i could pay you! or at least tell me which programs you used
@noobieplayzandanimates
@noobieplayzandanimates 2 жыл бұрын
Don’t forget about editing with adobe after effects!
@gabefernandez5915
@gabefernandez5915 2 жыл бұрын
This is the largest universe size comparison I have ever seen nice job on it so large it is wonderful and ginormous it is the best one ever so long I love it so much it is perfect it’s the longest I have ever seen
@TheYarikishere
@TheYarikishere 2 жыл бұрын
you deserve way more views. Beautifully done!
@SChome100
@SChome100 2 жыл бұрын
Why you copied me word for word 😒
@mazillaplays
@mazillaplays 2 жыл бұрын
I thought you were joking until I saw the video was two hours long! Good job
@noobieplayzandanimates
@noobieplayzandanimates 2 жыл бұрын
0:16: Pt. 1 0:17: Protoverse 0:34: Planck Length 0:47: Graviton 1:02: Tau Neutrino 1:16: String 1:30: Brane 1:44: Anti-Proton 1:58: Anti-Neutron 2:12: X-Boson 2:26: Muon Neutrino I’m to lazy to finish, can other people do it for me? Please!
@DominusGaming992
@DominusGaming992 2 жыл бұрын
Nope
@ICSSRTV
@ICSSRTV 2 жыл бұрын
Yeah
@DaughterofRevenge
@DaughterofRevenge 3 жыл бұрын
Great and entertaining size comparison video, overall! Also, looking for the title of the soundtrack for years-- 1:51:19 . hope someone may know what the soundtrack is called. Thanks.
@UniverseUA
@UniverseUA 3 жыл бұрын
Glad you like it! The music is called Stephen Barton - War Pig
@DaughterofRevenge
@DaughterofRevenge 3 жыл бұрын
@@UniverseUA Thank you so much!
@tatiandarwati6480
@tatiandarwati6480 2 жыл бұрын
You mom will happy
@tatiandarwati6480
@tatiandarwati6480 2 жыл бұрын
And
@GuynamedMrBitch
@GuynamedMrBitch 2 жыл бұрын
Universe UA u can make videos for u a blender physics bigolagy new movies or nice movies or uptade can do this Universe UA
@qoko
@qoko 3 жыл бұрын
Im very surprised bro it's amazing! How many hours you do that???
@UniverseUA
@UniverseUA 3 жыл бұрын
I've been working on the series since January
@qoko
@qoko 3 жыл бұрын
@@UniverseUA Ur really legend bro
@StickerPanckePChildern
@StickerPanckePChildern 3 жыл бұрын
@Mathis R.V
@StickerPanckePChildern
@StickerPanckePChildern 3 жыл бұрын
@Red / Blue Monke lol
@Wasp-39b-g61
@Wasp-39b-g61 2 жыл бұрын
@@UniverseUA what
@suganthaniranjan3087
@suganthaniranjan3087 3 ай бұрын
wow I like the coffe bean deisign
@alexandrevachon541
@alexandrevachon541 3 жыл бұрын
I like how you put music from Transformers: Fall of Cybertron.
@gruffcube
@gruffcube 2 жыл бұрын
i like how at the start you put the x button on mobile ads
@michaelhurley6072
@michaelhurley6072 3 жыл бұрын
Fascinating and terrifying at the same time. Thank you for this video! Bravo!
@buzzybees1239
@buzzybees1239 3 жыл бұрын
No
@buzzybees1239
@buzzybees1239 3 жыл бұрын
How i not done
@andysshitpostchannel6596
@andysshitpostchannel6596 2 жыл бұрын
@@buzzybees1239 ?
@howardmunro5464
@howardmunro5464 2 жыл бұрын
A BUCKEYBALL; ONE QUADRILLION DIAMETERS of MEV NEUTRINO/A SCHHOLYARD GAME MARBLE; 10 Million DIAMETERS of BUCKYBALL/ Approx 100 marbles go across the Expanse of one METER.
@Cheetos_senhor
@Cheetos_senhor 3 жыл бұрын
Here we go, probably the longest size comparison video in KZbin.
@ThisAVaporeon_3333
@ThisAVaporeon_3333 3 жыл бұрын
2179 objects
@ThisAVaporeon_3333
@ThisAVaporeon_3333 3 жыл бұрын
Add 23
@Spacemarioedition
@Spacemarioedition 2 жыл бұрын
im making a size comparison with at least 1k objects
@callielosee3692
@callielosee3692 2 жыл бұрын
nope forget the 2022 at the end of the year!
@luxuscat6563
@luxuscat6563 2 жыл бұрын
@@callielosee3692 Lets think about Universe UA make everything size comparison 2023
@jackdaniels6927
@jackdaniels6927 2 жыл бұрын
I like Blender and your animation
@howaidaelzein2573
@howaidaelzein2573 6 ай бұрын
1:08:06 I'ts Small, Not Smol.
@tranloc4537
@tranloc4537 2 жыл бұрын
Thanks you very much ! The video has more scientific and ultra intelligent from small to large ! 🥳🙂😃🧡🧡🧡💚💚💚
@howaidaelzein2573
@howaidaelzein2573 6 ай бұрын
01:08:16 Smol❌ Small☑️
@a_the_somehing_-.9058
@a_the_somehing_-.9058 2 жыл бұрын
Now that's an enormous video. Good job
@andysshitpostchannel6596
@andysshitpostchannel6596 2 жыл бұрын
That'll be fun to see these stars in the milky the same thing about it doesn't matter how many times can you take the time off boosters when texts about abilities are going here right now but everyone is going here right even though the weather is the weirdest dream about a car quick to eat and get back with another
@callielosee3692
@callielosee3692 2 жыл бұрын
0:18 smallest theory 0:36 smallest length 1:19 biggest theory 8:48 smallest neucles
@callielosee3692
@callielosee3692 2 жыл бұрын
MORE TO COME!
@ahs1795
@ahs1795 2 жыл бұрын
YES
@bkCheezburgor
@bkCheezburgor 11 ай бұрын
​@@callielosee3692 YESSSS!
@TheMelodicMess
@TheMelodicMess 3 жыл бұрын
Is this the whole thing?? Omg I’m so ready
@laiyemoboys9255
@laiyemoboys9255 3 жыл бұрын
Yup, this is the whole thing.
@kimkimashepherd8041
@kimkimashepherd8041 3 жыл бұрын
The whole thing is upto observable universe, beyond that was just an imagination
@KingBuffyTheThird
@KingBuffyTheThird 2 жыл бұрын
@@kimkimashepherd8041 I agree!
@myhamsterisbad
@myhamsterisbad 2 жыл бұрын
@@laiyemoboys9255 hamster? Cat? Rabbit? Shark?
@rajiandkuttustravelvlog7897
@rajiandkuttustravelvlog7897 2 жыл бұрын
wow bro you deserve like 59 million subs and over billion views
@Meandpigeoncoolio
@Meandpigeoncoolio 2 жыл бұрын
But it's just size
@martianmoonnumber1
@martianmoonnumber1 2 жыл бұрын
where did you get the noises for the quasi star and the black holes?
@UniverseUA
@UniverseUA 2 жыл бұрын
Here are the sounds that I used freesound.org/people/Kinoton/sounds/369516/ freesound.org/people/TimoSchmied/sounds/530974/ freesound.org/people/ejfortin/sounds/49692/ freesound.org/people/ejfortin/sounds/49679/ freesound.org/people/RICHERlandTV/sounds/216089/
@martianmoonnumber1
@martianmoonnumber1 2 жыл бұрын
@@UniverseUA thanks :D
@The_Awesome_One12
@The_Awesome_One12 6 ай бұрын
Absolutely fascinating❤
@snigdha8404
@snigdha8404 3 жыл бұрын
Oh yes!!! Amazing and fascinating!!!
@buzzybees1239
@buzzybees1239 3 жыл бұрын
@Ferrel Fadri ok
@buzzybees1239
@buzzybees1239 3 жыл бұрын
But i can do how
@andysshitpostchannel6596
@andysshitpostchannel6596 2 жыл бұрын
@@buzzybees1239 what
@fredwgioia
@fredwgioia 2 жыл бұрын
I love the comparisons
@rikingking02
@rikingking02 4 ай бұрын
0:19 protoverse
@Graylucy19
@Graylucy19 3 жыл бұрын
Thanks for making this video.... Now I can learn about universe....🥰🥰🥰❣️..
@Meandpigeoncoolio
@Meandpigeoncoolio 2 жыл бұрын
But Its just size
@andrefarfan4372
@andrefarfan4372 3 жыл бұрын
Great job.
@sm-hn9999
@sm-hn9999 3 жыл бұрын
This video also high graphics 4k Amazing
@iamsigma744
@iamsigma744 2 жыл бұрын
Great design 👍
@RedFlare15585
@RedFlare15585 2 ай бұрын
The fact he wanted to joke around so then he put an x for mobile game adds
@gabefernandez5915
@gabefernandez5915 2 жыл бұрын
What sounds did you use for the tank’s
@UniverseUA
@UniverseUA 2 жыл бұрын
The sounds are from the games World of Tanks and World of Tanks Blitz. I combined and/or stretched some
@Spacemarioedition
@Spacemarioedition 2 жыл бұрын
bro what th- HOW ARE YOU SO GOOD
@AnasAdam19
@AnasAdam19 3 жыл бұрын
uhh, im sorry, but, what is the first picture that you showed. i really don't understand?
@puffballoflogoedits
@puffballoflogoedits 8 ай бұрын
X button on mobile ads.
@puffballoflogoedits
@puffballoflogoedits 7 ай бұрын
X button on mobile game ads.
@StickerPanckePChildern
@StickerPanckePChildern 3 жыл бұрын
2:16:29 What Light years For Light yearsm
@Planet_139
@Planet_139 3 ай бұрын
Protoverse Plank length Graviton Tau nurtino String Brane Anti proton Anti neutron X boson Muon nurtino Y boson Electron nurtino Fermion Tacyon Calabi yau manfod Quantum foam Muon Plank particle Yotcometer 1 meV neutrino
@OneXL10
@OneXL10 2 жыл бұрын
Time Stamps (Work In Progress) 1 - Yottameter (1 YM) = 0.0000000000000000000000001 meters - 0:13 0:13 The Protoverse 0:31 Planck Lenght 0:45 Graviton 1:01Tau Neutrino 1:13 String 1:28 Brane 1:43 Anti-Proton 1:53 Anti-Neutron 2:11 X-Boson 2:25 Muon Neutrino 2:37 Y-Boson 2:50 Electron Neutrino 3:08 Fermion 3:20 Tachyon 3:36 Calabi Yau Manifold 3:50 Quantum Foam 4:01 Muon 4:17 Planck Particle 2 - Yoctometer (1 YM) = 0.000,000,000,000,000,000,000,001 meters - 4:40 4:48 MeV Neutrino 5:02 Top Quark 5:15 Preon 3 - Zeptometer (1000 YM) or (1 ZM) = 0.000,000,000,000,000,000,001 meters - 5:32 5:45 High Energy Neutrino 6:06 Bottom Quark 6:21 Charm Quark 6:35 Strange Quark 4 - Attometer (1000 ZM) or (1AM) = 0,000,000,000,000,000,001 meters - 6:39 7:02 Up Quark 7:15 Down Quark 7:30 Electron 7:45 Weak Force 5 - Femtometer (1000 AM) or (1 FM) = 0,000,000,000,000,001 meters - 8:02 8:18 Neutron 8:32 Proton 8:46 Hydrogen Nucleus 9:00 Tritinium Nucleus 9:11 Helium Nucleus 9:30 Lithium Nucleus 9:40 Oxygen Nucleus 9:53 Neon Nucleus 10:08 Chlorine Nucleus 10:22 Nickel Nucleus 10:34 Mercury Nucleus 10:50 Uranium Nucleus 11:03 Unonoctium Nucleus 6 - Picometer (1000 FM) or (1 PM) = 0.000.000.000.001 meters - 11:26 11:39 X-Ray Wavelenght 11:49 Sulfur Atom 12:03 Silicon Atom 12:17 Hydrogen Atom 12:31 Iron Atom 12:46 Ammonia Molecule 13:01 Water Molecule 13:13 Zinc Atom 13:27 Helium Atom 13:41 Copper Atom 13:55 Fluorine Atom 14:10 Oxygen Atom 14:23 Neon Atom 14:38 Nitrogen Atom 14:51 Mercury Atom 15:06 Oganesson Atom 15:20 Cadmium Atom 15:33 Flerovium Atom 15:46 Tennesine Atom 16:01 Gold Atom 16:15 Silver Atom 16:29 Palladium Atom 16:44 Carbon Atom 16:58 Magnesium Atom 17:12 Rhodium Atom 17:30 Chlorine Atom 17:40 Platinum Atom 17:53 Ruthenium Atom 18:08 Boron Atom 18:21 Idrium Atom 18:36 Nihonium Atom 18:51 Lithium Atom 19:04 Technetium Atom 19:22 Livermonium Atom 19:35 Aluminium Atom 19:45 Arsenic Atom 20:02 Bromine Atom 20:16 Zirconiuum Atom 20:30 Gallium Atom 20:43 Argon Atom 20:56 Beryllium Atom 21:10 Selenium Atom 21:25 Phosphorus Atom 21:39 Molybdenum Atom 21:52 Radon Atom 22:06 Fermium Atom 22:21 Einsteinium Atom 22:35 Plutonium Atom 22:49 Californium Atom 23:00 Nckel Atom 23:19 Osmium Atom 23:31 Neptunium Atom 23:44 Cobalt Atom 24:08 Krypton Atom 24:21 Lead Atom 24:35 Rhenium Atom 24:50 Vanadium Atom 25:06 Manganese Atom 25:22 Antimony Atom 25:37 Germanium Atom 25:52 Niobium Atom 26:07 Titanium Atom 26:24 Xenon Atom 26:40 Copernicium Atom 26:55 Tantalum Atom 27:11 Indium Atom 27:25 Thallium Atom 27:41 Hafnium Atom 28:00 Tin Atom 28:11 Sodium Atom 28:30 Neodymium Atom 28:43 Scandium Atom 29:00 Bismuth Atom 29:15 Calcium Atom 29:30 Thorium Atom 29:46 Promethium Atom 30:02 Praseodymium Atom 30:17 Iodine Atom 30:33 Cerium Atom 30:47 Barium Atom 31:04 Potassium Atom 31:21 Radium Atom 31:36 Rubidium Atom 31:50 Uranium Atom 32:06 Caesium Atom 32:21 Francium Atom 32:38 Alcohol Molecule 32:55 Ethanol Molecule 33:09 Adenine Molecule 7 - Nanometer (1000 PM) or ( 1 NM) = 0.000.000.001 meters - 33:27 33:45 Buckyball Molecule 34:00 Adenosine Molecule 34:17 Carbon Nanotube 34:36 Glucose Molecule 34:53 DNA String 35:11 Phospholipid Bilayer 35:48 Hemoglobin 35:45 Antibody 36:03 Bacteriophage 36:20 Ultraviolet Light Wavelenght 36:59 Blue Light Wavelenght 37:37 Cyan Light Wavelenght 37:55 Green Light Wavelenght 38:09 Yellow Light Wavelenght 38:27 Orange Light Wavelenght 38:43 Red Light Wavelenght 39:01 Infrared Light Wavelenght 8 - Micrometer (1000 PM) or ( 1 ...) = 0.000.001 meters (Sorry but the symbol keeps disappearing.) - 39:17 39:35 Lysosome 39:50 Y Chromosome 40:11 E. Coli 40:25 X Chromosome 40:43 Red Blood cell 41:00 Chloroplast 41:20 White Blood cell 41:40 Pollen 41:53 Thiomargarita namibiensis 42:11 Amoeba 42:29 Grain Of Salt 42:48 Grain Of Sand
@andysshitpostchannel6596
@andysshitpostchannel6596 2 жыл бұрын
A very simple interpretation is when you answer the phone to take an order, corporate restaurants encourage you to answer with a smile. It’s true you hear the person taking your order while smiling. He takes this idea to an utmost extreme and amazing talent.
@andysshitpostchannel6596
@andysshitpostchannel6596 2 жыл бұрын
An
@maiabxtchhh
@maiabxtchhh 3 жыл бұрын
amazing, really. good job man, this is incredible!!!
@howardmunro5464
@howardmunro5464 2 жыл бұрын
12,742,000,000,000 LYSOSOMES lined up back to back/Single File would be needed to span across the Diameter of PLANET EARTH.
@TheofficialJedisworld
@TheofficialJedisworld 2 ай бұрын
Why is there a sword? 52:15
@PleaseLeave-x2p
@PleaseLeave-x2p Жыл бұрын
This cuwld be in Netflix.11/11
@dENNY_vy
@dENNY_vy 3 жыл бұрын
This is everthing in My brain 🧠
@griwasswass5504
@griwasswass5504 3 жыл бұрын
Very great and entertaining 3D 4K 60FPS size comparison video! Also, I’m looking for the title of the soundtrack for a day-2:27:20 . I hope that someone may know what the soundtrack is called. thank you so much!!!
@yourfellowscratchjrenthusiast
@yourfellowscratchjrenthusiast 3 жыл бұрын
@Ferrel Fadri i see you everywhere
@flarest5697
@flarest5697 3 жыл бұрын
The song is Rise of the Harkoonken
@YuRiSunga
@YuRiSunga 2 жыл бұрын
Color of VV Cephei A at 2:06:10 is wrong. This is a reference to older size comparisons, dating from 2006 - 2010
@adriana-istrate
@adriana-istrate 2 жыл бұрын
VV Cephei A is red
@katerinapeklenk1269
@katerinapeklenk1269 2 жыл бұрын
I recently started noticing audio glitches (notably some of the music is cut out) in this vid and I don't know if it's just me.
@UniverseUA
@UniverseUA 2 жыл бұрын
Yep, had to remove some music due to copyright
@googolologylover
@googolologylover Жыл бұрын
Yea,there.were green stuff popping around the screen at around the first hour
@flarest5697
@flarest5697 3 жыл бұрын
8:02 Weird music
@Damariein
@Damariein 5 ай бұрын
Naw
@You-rl7gc
@You-rl7gc 2 жыл бұрын
To understand how small the Planck length is, I will say the following: a person is as much longer than the Planck length as a person is larger than an object that is about 100 million times larger than the observable universe. And that for the Planck length, in human equivalent, the observable universe is an object that is about 3 times the width of human DNA. And I will also say that in the middle between the dimensions of the Planck length and the observable universe there is a grain of sand about 0.1 millimeters in size.
@jnmjimenez1729
@jnmjimenez1729 9 ай бұрын
You deserve more more more more more more more more more more more more more more more more more more more more more more more more more more more more more 1 million times more comments and likes subscribers and stuff!!!!
@ShapedExtract
@ShapedExtract 2 жыл бұрын
I love this vid 2000000Ly+ Of Size Of coolness!!!!!!!!!!!!!!!!!!!!!!!!!!!
@rebeccabuckland8311
@rebeccabuckland8311 2 жыл бұрын
I subscribed.😇
@UniverseUA
@UniverseUA 2 жыл бұрын
Thanks :)
@mazillaplays
@mazillaplays 2 жыл бұрын
Me too
@ミラクルミュージカル
@ミラクルミュージカル 3 жыл бұрын
New things that changed: Unonoctium: The new name for unonoctium is Oganesson.
@jnmjimenez1729
@jnmjimenez1729 9 ай бұрын
No, don’t listen to him. It’s called unonoctium!😡🤬😾😿
@maximilianocortes
@maximilianocortes 2 жыл бұрын
2:10:36 This black hole Messier 60 is the most voices from MONSTER
@andysshitpostchannel6596
@andysshitpostchannel6596 2 жыл бұрын
Enjoyed!
@network4dimension62
@network4dimension62 2 жыл бұрын
1:20:53 No, Earth is alien's prison! 🌚 The moon alien's are proof of ours!
@2pamper633
@2pamper633 Жыл бұрын
Is it the correct sizes?
@gabefernandez5915
@gabefernandez5915 3 жыл бұрын
Great job too
@gabefernandez5915
@gabefernandez5915 3 жыл бұрын
Good 👍 job ok
@scratchthecatqwerty9420
@scratchthecatqwerty9420 2 жыл бұрын
Error: at 23:10 spelled Nckel instead of Nickel.
@FeatherBoa-zt8ql
@FeatherBoa-zt8ql 2 жыл бұрын
IT IS 2 HOURS
@cjjuarez10
@cjjuarez10 5 ай бұрын
BE PASSENT
@PleaseLeave-x2p
@PleaseLeave-x2p 5 ай бұрын
your size comparison is less than 2 hours
@ryanswatson
@ryanswatson 4 ай бұрын
Geometry Dash icon
@Mewing19
@Mewing19 3 ай бұрын
make it x2 speeed to make it 1 hour🤓👆🏻
@debshreebasu8137
@debshreebasu8137 3 ай бұрын
Omg
@howardmunro5464
@howardmunro5464 2 жыл бұрын
A lightyear is something like 8,985,456,300,000 KILOMETERS.
@Meandpigeoncoolio
@Meandpigeoncoolio 2 жыл бұрын
Imanige how much kilometers is in 93 billion light years
@MazdakLindsey
@MazdakLindsey Жыл бұрын
@@Meandpigeoncoolio how about 3760
@cydcharissvaldezssg6384
@cydcharissvaldezssg6384 3 жыл бұрын
I like ur size comparision
@SpanishBall639
@SpanishBall639 2 ай бұрын
Uranus left the chat 1:29:00
@rainbowflower5008
@rainbowflower5008 3 жыл бұрын
I just like planet and all of universe
@The_Awesome_One12
@The_Awesome_One12 9 ай бұрын
Planets are in the universe
@sk84lifedb
@sk84lifedb Жыл бұрын
fire instrumental starts at 57:36
@Spacemarioedition
@Spacemarioedition 3 жыл бұрын
you are so underrated, you should have at least 100k subs, not 13k
@thiagofleck3468
@thiagofleck3468 3 жыл бұрын
Okay, but the bug that starts in part 8 where green flashing lights start to pop up hasn't been fixed.
@UniverseUA
@UniverseUA 3 жыл бұрын
Unfortunately, I couldn't fix it because re-rendering that would've taken eternity
@Carsyen362
@Carsyen362 3 жыл бұрын
@@UniverseUA Where is Horsehead nebula and the other smaller galaxies and I think Orion Nebula is In thes but I promise I’m not trying to be a critic
@Fjfjjdckdk
@Fjfjjdckdk 3 жыл бұрын
@@UniverseUA it's really bad and distracting
@leonidpopov9277
@leonidpopov9277 2 жыл бұрын
@Universe UA that was a sad comment
@ShapedExtract
@ShapedExtract 2 жыл бұрын
Its's at 1:31:21
@thepooterrooter3917
@thepooterrooter3917 3 жыл бұрын
I was just thinking, we are part of the universe... What if our conscious selves are nothing more than a particle of matter? That would kinda put a damper on every religion... We know nothing...
@laiyemoboys9255
@laiyemoboys9255 3 жыл бұрын
At 01:45:00 you didn't fix Alpha Centuari B's diameter.
@cristianomartinsdearaujo6500
@cristianomartinsdearaujo6500 3 жыл бұрын
Not 112.280 km its 1.112.280 km
@suvoshreebose9311
@suvoshreebose9311 2 жыл бұрын
This ... is like a movie
@The_Awesome_One12
@The_Awesome_One12 9 ай бұрын
Right.
@MFA398
@MFA398 8 ай бұрын
"The x button in mobile game ads"
@reality3166
@reality3166 6 ай бұрын
4 millimeters
@raingameryt738
@raingameryt738 2 жыл бұрын
This needs more likes/views
@raingameryt738
@raingameryt738 2 жыл бұрын
Seriously You made an incredible vídeo!, i love it, You worked so hard. This needs more likes
@raingameryt738
@raingameryt738 2 жыл бұрын
Bro it Makes sense that You put The x button before protoverse
@UniverseUA
@UniverseUA 2 жыл бұрын
Glad you like the video! And found the Easter egg!
@mihogup
@mihogup 2 жыл бұрын
So cool!
@Mangoman-1z23
@Mangoman-1z23 2 жыл бұрын
Bro I love this Music
@Iliedavidrealchannel
@Iliedavidrealchannel 2 жыл бұрын
2:28:50 mandelbrot like drip zoom🤣
@shrek7824
@shrek7824 2 жыл бұрын
Isso afeta até o Grêmio 👏👏👏
@American512
@American512 Ай бұрын
1:05:34 What music is that!?
@lediep88
@lediep88 10 ай бұрын
Don’t forget the cat’s eye nebula!😅
@laiyemoboys9255
@laiyemoboys9255 3 жыл бұрын
Checkpoint: 19:49
@GoldenCheeseFries
@GoldenCheeseFries 2 жыл бұрын
Wow awesome you thought us everything
@dariogoricki4205
@dariogoricki4205 3 жыл бұрын
stunned
@samanthaed1
@samanthaed1 2 жыл бұрын
Top 5 smallest things: 5th Smallest: Tau neutrino 4th Smallest: Graviton 3rd Smallest: Plank length 2nd Smallest: Protoverse The smallest: X button on mobile game ads.
@ariljamal8704
@ariljamal8704 Жыл бұрын
Yes
@robertmichel8456
@robertmichel8456 Жыл бұрын
SO TRUUUUEEE
@IAteAnAK47
@IAteAnAK47 Жыл бұрын
@Thetommymasterthe joke flew 5,000 miles away from your head
@IAteAnAK47
@IAteAnAK47 Жыл бұрын
@jeanpierfinalcupalarcon2023 bro the joke is a meme
@IAteAnAK47
@IAteAnAK47 Жыл бұрын
@jeanpierfinalcupalarcon2023 it’s sarcasm
@dawna9641
@dawna9641 3 жыл бұрын
I love science
@MandelbrotSetStudios69420lol
@MandelbrotSetStudios69420lol 2 жыл бұрын
Where are the musics that are in the 2 hours?
@pozetiv8688
@pozetiv8688 3 жыл бұрын
Infiniy < Absolute infinity
The Biggest Numbers in the World Size Comparison
10:06
Ridddle
Рет қаралды 3 МЛН
Ice Cream or Surprise Trip Around the World?
00:31
Hungry FAM
Рет қаралды 22 МЛН
Smart Sigma Kid #funny #sigma
00:33
CRAZY GREAPA
Рет қаралды 16 МЛН
Noodles Eating Challenge, So Magical! So Much Fun#Funnyfamily #Partygames #Funny
00:33
Slower Than Light Interstellar Travel
9:31
Spacedock
Рет қаралды 129 М.
EVERYTHING Size Comparison 2021 (Full) 3D 4K 60FPS
2:31:14
Universe UA
Рет қаралды 137 М.
The Universe Size Comparison 2024-Part 1
8:08
Joseph William Pelobello
Рет қаралды 539
Every Level of Civilization Explained
15:19
The Paint Explainer
Рет қаралды 1,4 МЛН
Journey to the edge of the Observable Universe
10:03
Spacetime
Рет қаралды 6 МЛН
Density of the Universe Comparison
8:41
Sciencephile the AI
Рет қаралды 788 М.
Country Size Comparison  All 195 Countrys | LeeZY Comparisons
6:24
LeeZY Comparisons
Рет қаралды 14 МЛН
Animation vs. Physics
16:08
Alan Becker
Рет қаралды 30 МЛН
Universe Size Comparison | 3D Animation Comparison
11:07
Galaxian Journey
Рет қаралды 3,3 МЛН