Harvesting 3 dozens of 45 days old rabbits│Treating Fur loss & Bacterial skin diseases of rabbits

[@nian60]

There is a vaccine against myxomatosis. It's called Nobivac Myxo-RHD Plus.

[@zapicoreymarl.418]

Thanks sir

[@zapicoreymarl.418]

Thank you very very much 💕

[@Max23465789]

In the United States it costs about $6000 to treat 100 rabbits for one year," you have to re-dose annually ." aetapet.com/how-much-do-vaccinations-cost-for-rabbits/#:~:text=the%20get%2Dgo.-,How%20Much%20Will%20You%20Pay%20for%20the%20Rabbit%20Vaccination%3F,Myxomatosis%2C%20which%20is%20another%20%2420.

[@King-oo9ei]

kzbin.info/www/bejne/gmimf3VqjKxnbNE

[@jeffharris96]

Except this is not Myxomatosis, or if it is it’s the first ever case in the Philippines, much more likely to be ‘Snuffles’ can be avoided by better husbandry and well ventilated housing... hence Dexters rabbits don’t have it.

[@ositaurama2243]

I'm glad that you gave that youngster an opportunity to talk to us. It's will help them to grow whenever they decide to follow your footsteps.

[@alisonshanahan9529]

He did so well, very articulate and to the point.

[@reneebrown2968]

Glad to see one farmer helping another. Says alot about your character. May God bless you in all your life.

[@Legoldos]

blessing for someone who have rabbits on wire flooring, thats a torture and deserves curse not blessing

[@Bamaman14k]

Sir Dexter I have been a doctor for more than 30 years, and I am always impressed with your knowledge of veterinarian medicine. The care and love you provide for your animals is apparent. The smart man always treats his investments well, and therefore enjoys the fruit of his labor. I love watching your videos, I always learn something from them. You are truly a philanthropist Dr Clark

[@felixfelix2576]

Pretty sure he has a very on staff. He can't know everything.. plus he is wealthy.

[@yumikawi8816]

You truly love animals

[@uchibauki2515]

Because it’s easy to buy medicine or even vaccine in other countries without doctor prescribed it, here in America everything has to ask doctor that’s why very costly just to have dogs cats also rabbit, we feel robbed by the vets, sorry but that’s true😓

[@hannatjiehangula7556]

@@111119jai qqqqpl

[@theprof73]

I know more than this yokel and actually give sanctuary to rabbits instead of exploiting them.

[@yamabegt1365]

Hi uncle dexter im a rabbit breeder and i started breeding rabbits when i was 12 years old and now im 19, i can produce 20 rabbits a month. I hope I can be successful just like you someday.

[@nayigabrenda7400]

Yes u can be successful just believe in yourself

[@alisonshanahan9529]

Ivermectin is great stuff, I use a drop of the liquid on the back of my birds heads to get rid of parasites. My dogs get it too for ticks and fleas. I recently watched your video on fumigating your farm to get rid of mosquitoes, seeing the state your neighbours poor rabbits were in due to lack of fumigation was a shock. Your insistence on prevention and your shoe washing station at the entrance of every building is certainly paying off. No big vet bills or animal losses for you! You are teaching a new generation the importance of cleanliness, of making sure the animals in your care have the best life, food, fresh water and shelter. You teach them the value of the work they are doing, how much they can earn by producing high quality products in top condition. This is why your website is growing worldwide, nobody else is doing what you do. By the way, I love the bamboo fences, they look like they should be on an expensive country estate, they are sensational, congratulate your builder on his excellent job.

[@mariasantana-abreu5401]

I wants to move to the Filipines, because y love animals. I envy you in a good way, God bless you all. From Rep.Dominicana.

[@astigmatv3749]

Hi can u please help me i want too build a rabbit farm too. I just need sponsor because i have no budget. Thank you

[@justinereyes7820]

@@astigmatv3749 sa 1k may pair kana

[@ramachandarbehera1958]

@@justinereyes7820 noooo

[@saranghaeboy2430]

Not really. Don't expect too much

[@altafshekh837]

@@justinereyes7820 58

[@Skashoon]

Your helpers are impressive. They work hard and I see that they are glad to work. It’s also good experience and attitude that you give to them. One day they will also be good farmers.

[@alisonshanahan9529]

I too am impressed by how willing and how hard they work. They respect Dexter and he respects them in return, no wonder they work so hard for him.

[@michaela-be4le]

Dex, the reality is that nothing is without its trials. Thankfully hard working folks such as yourself help us all to achieve success :)

[@DextersWorld]

Good day to you my friend hope all is well with you michael.

[@annalynsantanez3227]

Binebenta po ba yong rabit

[@chanellethomas6886]

I can see that you really care about the animals you're raising but please hear me out. Water bottles, Water bottles are not adequate for rabbits as it's very difficult for them to be able to get enough water, especially since they're designed to only let one or two drops out at a time. Rabbits drink as much as a large dog and require a large water bowl available at all times. I did notice that you have some water bowls but please throw away the water bottles. Mess flooring, Wired or mesh flooring can cause sores on a rabbit's feet, they're known as sore hocks and are very painful for them. Hay, The bulk of a rabbit’s diet should be hay, this should be accessible at all times in unlimited quantities as it keeps their guts moving. Hay consists up of 80% of a rabbit's diet and should NEVER be skipped out on as they're likely to develop GI stasis or other health concerns. Also please look at proper guidelines on how to pick up a bunny here on KZbin. Please also don't forget about how many rabbit's are at shelters needing homes. Millions of Rabbits are euthanised every year due to them not being able to find homes.By breeding rabbits you're contributing to the overpopulation of Rabbits. Please take into consideration on what I've said, especially the point I made about hay as it's crucial for their diet :) Sidenote be careful about mixing up the kits, I'm assuming a lot of them were weaned and seperated but for the kits that you put back with their mother's you don't want to mix up their scents or the buns as the parents could end up killing them

[@knkfarm8660]

I own a lot of animals and I do research about them before getting them so I know what to do and how to care for them. If it's a situation where they need to be rehomed immediately and no one will get them and you have space for them get an area set up for them and get them home then do research about that specific animal/pet and then get their pin/cage set up properly. I would love it if people can do research for the animals so they know how to properly take care of them. holding bunnies, The way he is holding the bunnies is not ok. Holding them by the back skin/fur can seriously harm/hurt them. How to properly hold them: Placing one hand under your rabbit's chest. Place your other hand under their hind legs. Lift your rabbit and hold them against your body to keep them nice and secure, but don't squeeze too tight. Temperature, If it's to hot outside for bunnies they will have heat strokes and die, what you can do if it is to hot outside is put ice in their water and give them shade. If it's too cold they will freeze to death, what you can do if it's to cold give them hay, hideaway, block the cold wind with a tarp. Food/water, Hay and fresh grass is 80% of their diets, water bottles should be thrown away and replaced with water bowls. Give them fresh cold water every day. flooring/living conditions, The flooring is not ok the wire can cause sore hocks/ bumble foot which can cause pain to the bunnie. Bunnies should have some sort of hideaway so they can hide from the sun and keep warm, some wood to chew on to keep their teeth short so they don't grow to long and cause pain, something that can shorten their nails, at least half the cage needs to be solid flooring so they can have a break from the wire.

[@aamichael4628]

@@knkfarm8660 very informative. Thanks.

[@TechPopop]

I like rabbits and chickens that is why I always watch your videos.

[@heartlandokie4485]

Plant Rosemary around your rabbit pens. Insects hate its fragrant smell it leaves in the area. When you prune the rosemary back, take the stems and rub them on the cages outside or the rabbits being attacked. the rosemary oil will act as a natural repellant. It also works on people when you rub it on yourself.

[@abdoulieceesay1155]

hi

[@prossyprossy5460]

Thank you darling 💕 🌹 for the good heart ♥

[@prossyprossy5460]

May God bless in Jesus name 🙏

[@kunledare316]

Hi

[@kunledare316]

Like the vid

[@AGA-ORAGON]

wow ang ganda sir..nagsisimula din po ako ngayon sa rabbit meron po akong magasawa sana dumami rin katulad diyan sainyo..

[@vibhugupta1305]

I am so glad there are people like you in this world ☺️☺️☺️

[@gisella.antuanethsandovalr1791]

Nono

[@iona5439]

Why... hes going to eat the rabbits

[@andrewmendoza598]

Nakakatuwa andami nyo po rabbit, sarap panoorin, galing nyo pa mag english, very clear and correct grammar 😊😊

[@jeffharris96]

FYI this is unlikely to be Myxomatosis as it’s never been reported in South Asia, if it is then it results in 99% death in European rabbits. Possibly Pasteurella (Snuffles) which is a bacterial infection brought on by stress, overcrowded conditions and poor ventilation. Treatment has variable success depending on the severity of the symptoms. You can use an antibiotic called enrofloxacin, orally for up to three months, followed by probiotics to restore beneficial gut bacteria. This is why your very well designed rabbitary is great fro them. 🙂 Also, while picking up the rabbits like a handbag may be convenient it really isn’t the right way to do it, they should always be supported with a hand under the rump, grabbing a handful of skin is painful and can separate the layers of skin from the muscle underneath.

[@missyrabbit5250]

BunnyVac is a Pasteurella multocida vaccine for use in healthy rabbits . We vaccinated our rabbits with good success.

[@soxpeewee]

Baby rabbits have a ruff like a kitten to grab

[@Username-fc2ll]

Salamat jud kaayo sa imuhang gitudlo sa akoa Sir Dexter nakatabang jud ka sa akoa na maka income ko ug ginagmay. Watching from Davao 17yrs old

[@dontworrydehappy7104]

I have never seen rabbit dens underground! What a great idea! It's cooler and they have more privacy. All of your farm looks so nice and clean! :)

[@ianharbjorn]

Sana po dumami po yung magalaga ng mga rabbits. Good alternative food source and good animal companions. Nahahati mga opinions namin when it comes to legal rights of rabbit meat. Thanks po for the infos 😊

[@oneup1098]

GREAT STUFF DEXTER - IF YOUR WHOLE ISLAND HAD A HAND IN AN ANIMAL TRADE AND AN CROP TO EACH DAY WOULD BE A BLESSING AND MORNINGS COULD START WITH CHORES FOOD AND SPARRING AND DUELS - THEN A TRIP TO SEE THE ELDERS FOR MORE GUIDANCE THEN HOME VIA FRIENDS AND MARKETS TO ATTEND TO THE FAMILY HERD - GREAT STUFF DEXTERS WORLD

[@MrDenx-lq2wj]

the best thing in this channel is he always speak English...that is why many people will watch from all over around the world

[@wadsky23tv55]

Hello Dexter world.you can inspire the farmers to take care of their pets

[@MARLENECARINAL]

Thank you DEXTER YOU ARE SUCH A GOOD PERSON WITH GOOD HEART TO SHARE OTHERS .

[@nathanchannel2531]

wowww .... cool🤩 ... I really like rabbits. greetings from Indonesia🙏

[@DextersWorld]

Thank you very much!

[@nathanchannel2531]

@@DextersWorld 🙏🙏🙏

[@johndesena5122]

Nakakatuwa Naman po Ang kasipagan ninyo sir! 🙏💪😊

[@HeavenBunnies]

Man, you seem like a nice and passionate guy but my heart breaks for these bunnies.

[@sharongraven]

Why...? He’s actually doing 10x better than about 80% of rabbitrys I’ve seen. Most don’t even give veggies :(. They look healthy and they all have sunlight except for the ones raising kits.

[@willdwyer6782]

This guy's running a decent meat rabbit operation. His neighbor, on the other hand, is doing everything wrong. His neighbor's worst offense is allowing his birds to come in close contact with his rabbits. That's most likely why his rabbits are sick with pasteurella.

[@joaobosco177]

qpgslgaldelgaphalgwkdfllelfmiwphwlmslfkwlls

[@quvonchbek7306]

🦡🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🦢🐤🐤🐤🐤🐥🐤🐤🐤🐤🐥🐥🐥🐥🐤🐥🐤🐤🐤🐤🐥🐥🐤🐤🐤🐤🐤🐤🐤🐤🐤

[@leo-zr5zs]

Grabe bai Dexter, maka inspire man ka bai, basig pwede ta makapalit ug rabbit diha balita nako new zealand white nindot buhion pang karne, first ti,e jud nako magbuhi

[@HiddenSpringFarm]

Nice video Dexter, good info about possible rabbit issues. Next year I’m planning to add rabbits to my farm stay. I’ll include it on my channel too. Not for meat, but for an attraction to the farm stay, adding manure and possibly breeding/selling bunnies. I love the colourful ones.

[@jaimaruthi360techfeed8]

not for meat..lots of love and thanks

[@mohammedawal9476]

Is good you are teaching us God bless you

[@afraannypatutieetv6635]

Kol dexter very nice po ang raising methods nyo po i also a fan of raising rabbits... Godbless po dexters world

[@jimesmarariola2494]

I really love this vlog,I am also have 3 rabbits and I love them so much💕hoping I have more rabbits

[@angelitalaurente9]

Ang sarap hingin nung yellow na rabbit. Cute cute!!!

[@benstopia8990]

Sir dexter u are my inspiration to keep on petting fish and taking care of them I use your tips on how to care for fish and Betta ty for inspiring us

[@rotchieadona51]

Ang cute po nila🥰 parang gusto ko n din mag farm ng rabbits 🐇

[@emmanuveljacob7027]

Amzing rabbit hutch dexter really love the idea of providing privacy. Reminds me of my pet rabbits. I used to apply a lotion named ascabiol, very effective against this kind of virus.

[@brudleyarcellana1159]

Super galing mo po sir...idol ko po kayo..pati sa mga goldfish at koi..god bless

[@douglaskufre-abasigilbert6941]

Great work Dexter!

[@MisslyTheCountrysideLife]

Siguro kapag ako may alagang rabbit.. di ko kaya silang katayin.. dahil sa napakabait nilang mukha ata ang cute pa nila

[@backyardfarminggardening9687]

Such a good person and a hard-working person. I salute you Sir Dexter😊❤️

[@iongitnomemes4383]

Dapat po bakal po ang kulungan ng Rabbit😅

[@thesolefarmgirl]

Very impressive sir dexter.. I ❤️❤️ watching your vlogs... more power and God bless!

[@jbsuedeadventure9276]

Thank for the update sir dex.....rabbit farming is so nice...hope you also lift us small backyard farmers....thank you and more power...

[@efraimboyles792]

Kanindot baya maka encourage og buhi sa rabbit 😊

[@ewakraft5770]

Tipp when u take the kittens away from the mother, let the smallest kitt stay with the mother for one or 2 weeks longer. It is less painful to the milk reducing processs for the mother and the change that she get mastitis is a lot less. Also give more real food minimum 3 weeks befor u take the kitten away, so they can learn. But im shure u do that. Good video, thank you ❣

[@nalubowarehema1101]

Wow Thanks for sharing I am a Ugandan lady but I've loved the way you do your things

[@aleenasarfraz5679]

I really wish you would place blankets or hay at the bottom of the rabbit cages, the wire is really bad for their feet and can cause sore hocks, they are very painful for them

[@MattrixNY]

The problem with that is then the rabbits poo all over the bedding and they end up walking in their own filth, which is also bad for them.

[@clairah8700]

@@MattrixNY Well they can at least clean their cage once a day instead of hurting the rabbits. Seems like they don't really care about the bunnies

[@madbrawler4398]

That’s why i can tell that this idiot guy knows nothing about the proper way of handling rabbits..

[@chanellethomas6886]

@@madbrawler4398 Also there's no hay I'm surprised they're still alive honestly :( The troubling thing is how confident he sounds about how he's treating them, I must admit the way he picks them up rubs me the wrong way

[@amandaengelman5168]

Many breeders keep them on wire with no issues. Having them sitting in their filth is much worse for them. Rabbit pellets are a complete diet. Many breeders never give hay and their rabbits live long, healthy, productive lives.

[@evanxg852000]

I really like the way you have laid out the maternity under the other cages, it would be nice to see a more detailed view of the plan

[@susantobias547]

they so cute😍

[@renopentecostes761]

Excellent explanation, this channel is surely helpful to everyone that have their own livestock. Thank you

[@ivancerepes6690]

Beautiful farm and animals, as fellow farmer i recommend you to put under the rabbits either straw, hay or residue of fine Wood after you cut Wood with chainsaw. Rabbits don't dwell on moist ground.

[@professorjvlogs5165]

Speechless ko sa imo vlog sir!...walay lain sulod sa ako huna2x kon dli ang pagka believe sa imo!...isa ka sa mga garbo sa mga visayan vloggers..kaingon ko una foreigner ka Vietnamese,Thai,Malaysian or Indonesian ka,tungod kay fluent ka kaayo mo inglesh!...tungod ana Mas nitaas pa ako pangandoy na mapareha ka successful sa imo sir someday!...nagabuhi pod ko og rabbit sir maong nakita ni nko imo Channel pero dli lang ni nko ma content ky funny videos man ako nesch...bag ong higala ko nmo sir,..tana Maka bisita pod ka dri sa akung balay..full support from Surigao City!

[@sgt_retiredcharlie4102]

Dexter, you are an awesome human being and we love watching your very informative videos and we love seeing how much you care about all your animals! God Bless you and yours, brother! From Tennessee, USA.

[@DextersWorld]

I appreciate that!

[@jamalnasir5781]

@@DextersWorld Which medication is being referred to inject the rabbits with? Can you please name it..

[@HungTran-jk7lm]

Thỏ mẹ sắp đẻ mới nhốt dưới hầm đó hả a.k thấy cho nó ăn như nào .a chia sẻ thêm dc k ak.e thấy rất hay và đang muốn làm theo

[@wonderdelfino6696]

Verry close to hit 1million Congrats dexx

[@meganbaker3825]

So glad I found your channel! You're amazing with the care of your animals. God bless you.

[@dioniciaacosta7134]

C da gdh

[@RubenDan-ml6ol]

Hello Megan, how are you doing today.

[@janc8199]

Thank goodness..they're animal lovers, and the Rabbits are their pets. Love seeing all the different animals.

[@williamk1452]

Awesome farm Dexter! I thought you were raising rabbits for food. I have raised pigs and goats, but bunnies are too cute!!? You run your farm very well. It inspires me greatly.

[@alisonshanahan9529]

Rabbits taste wonderful. I grew up in country Australia in the 60s, everyone ate rabbit, it was the staple diet as it was free. It was a great shame when they released mixamatosis in the late 60s, a lot of people lost jobs and many families went hungry.

[@muhammadyousaf9682]

A very good system of keeping rabbits and managing their cells, food and medication. Pls keep us informed about other pets like swans, turkeys, chicken, etc.

[@arwaaxcade5512]

I love your channel Allah bless u

[@myworldinfo7164]

Love the way of your rabbitery ♥️❤️♥️♥️❤️😍😍

[@DextersWorld]

Thank you! 😊

[@SnowNeo6000]

God bless you sir❤️❤️

[@momina2304]

So cute rabbit 🐇

[@gvbalajee]

WoW friend love from india,chennai - your words are so TRUE and gives POSITIVES vibes so nice of you great HUMAN so blessed always like this forever great keep going...

[@lexiedgrooms5361]

The animals make you happy Dexter that’s probably why you’re happy all the time

[@RubenDan-ml6ol]

Hello Lexie, how are you doing today.

[@NHikam]

I hope one day my dreams come true. Rearing rabbits Is my second plan I'm very passionate of it. When I was young we used to hunt it from the Forrest locally we call "Bakeyle" in Somalia🇸🇴. I appreciate your restless support

[@skyblackholles5403]

Somali waryaa qof soomaali ah lagama waayo meel kaste ee sxb soo dhawoow maxaad samay saa chenal kan waad soo booqatay ma xayawaanada ayaad xiisay saa sxb

[@NHikam]

@@skyblackholles5403 . Haa bro waxaanba leeyahay meel Poultry farm ah. Marka Dalka inaan dadka dunida ku nool barnana waajib ayaa naga saaran. Videos-ka aan sameeyo waad arki kartaa

[@abdinassirmuhamed4492]

Food security is very important walalkey and it starts from mixed farming or agriculture and dexter is a perfect example and I hope we benefit from him and better our lives in somalia. I'm a fan of dexter for a long time now

[@skyblackholles5403]

@@NHikam waan xiiseeyaa ee chenel kaaga magiciin intee ka daawan karaa chenal miyaad lee dahay

[@NHikam]

@@skyblackholles5403 . Kan ama Tahrib-did Poultry farm. Thanks

[@northeastmixtureoffi8088]

Yeah dextr is natural man👌🏿👌🏿👌🏿👌🏿👌🏿👌🏻

[@amanp3059]

Hope there is less loss due to the flood. May God Bless everything abundantly.

[@HAAJEN86]

Pls give me a subscribe

[@kasozigodfrey9496]

Hi mr Dexter I would like to get some knowledge on how to build underground rabbit cages . Thank you.

[@etmontnurcellari9964]

Super super super vella flm te gjithve ju dimofte ZOT ZOT vella flm ZOT

[@99prashantha1]

Love from India..Fantasic info on the rabbit farming..one question from me, how do you clean the soil / ground after the rabbit and kitten are taken out . Do you actually clean it regularly like once a week ?

[@angelahouston5561]

Thank u from the bottom of my heart for loving these Bunny's

[@DextersWorld]

Hello Angela you're welcome. Where you from?

[@angelahouston5561]

@@DextersWorld I'm from Washington state.

[@angelahouston5561]

U know because they r a rabbits people don't care they say there r just an animal. And not family mine little guy he is my world.

[@DextersWorld]

@@angelahouston5561 Oh Im glad to hear from you. Thanks for your comments. I can feel you.

[@blueeyes5483]

@@angelahouston5561 TRUE. RABBITS ARE MORE THAN JUST PETS. THEY ARE FAMILY 💖❤️💕💕💕💕💕😍😍😍🐰🐰🐰🐰🐇🥰🥰👍🏻👍🏻👍🏻MINE HAS 8 YEARS OLD & I LOVE MY BUNNY SO MUCH💖💕❤️ THEY ARE VERY LOVING 🥰🥰🥰🥰 BUNNIES ARE JOY😍😍😍 THEY BRING HAPPINESS 💖💖💖😘😘😘😘😘😘😘😘😘

[@antiquenoblogs8258]

Thank you so much Sir Dexter, I've been watching your videos, and I am starting to raise a pair of rabbits. God bless and keep on uploading videos.

[@joaobosco177]

Domingos.dlmdlnskndmhskhwlnskfdmgeknskjlvdlfdlgmdmdmdkhal pwpldldkjelmzlgodkdohi3or950ye0tieotyjrktktoynglgbmnslfmflflfldkgs

[@azamkhan8963]

I always learn something new from Dexter's World.

[@lonestarwolf-lv9zt]

Why why they sooo cute 🥺🥺🥺

[@dhextherjohn6581]

Sana kahit rabbit lang po ngayung pasko❤️❤️❤️

[@tinaosas6184]

This is One of dream, but is infortunate, i can not realised It.

[@humairakhan7413]

Aww these are tooo cute۔۔۔ kzbin.info/www/bejne/qpuYqKqGpNmAirs check this too

[@bindithav4239]

O also want a ton of fish And my favourite fish is betta But i can breed them but i can't grow them I dont know why I give them live food added almond leaves checked everything

[@rexlimvlog207]

Wow kadaghan SA anak sang imohang rabbit oy sir Dexter God bless

[@Aquatic_zone]

Sir Dexter , Failure is nothing but the way to success 🤗

[@mustafayucel2778]

Türkiye den Konya Kulu dan selamlar çok güzel olmuş teşekkürler tenkyou tak amazing Maşallah Sübhanallah beautiful admire tenks teşekkürler

[@ponsphrskul7983]

Wow, I want it. I love it.

[@teresasmiley4491]

I love your personal loving way you treat your animals good job God bless I will continue to watch your videos thank you very much👍❤️❤️❤️❤️❤️

[@RubenDan-ml6ol]

Hello Teresa, how are you doing today.

[@ivanfisher5148]

Excelente video hermano siempre tienes algo muy bueno para nosotros saludos desde México te mando un fuerte abrazo y bendiciones para ti y tu familia

[@DextersWorld]

Muchas gracias hermano ohla tambien na buen salud tu y tambien tu familia. stay safe!

[@ivanfisher5148]

@@DextersWorld muchas gracias.

[@rizaflores]

Thanks for the info

[@abubakarihtarimo7660]

I love it 💟

[@fernancabacungan362]

Ivermectin lng naman palang ang gamot sa mga ganung sakit ng rabbit sir .. sayang dko to napa nood agad.. namangay na ang dalawa kong rabbit🥺.. thanks for sharing sir God bless you po

[@yamyamchio3772]

Hi Dexter, I've been watching you for such a long time now. This rabbitry, my friend gave me a pregnant one due to deliver on the first week of August. May I ask where to buy the ivermectin? I am from 🇵🇭 too. Just in case I might need it someday. My kids loved the pets. Thank you for your information and experiences. It's quite inspiring 🤩

[@mangaofelicidad4068]

You can buy at LAZADA

[@Denzkitv]

it is available in any agri supply because it is using also in other livestock

[@bhong9127]

Ang ganda ng lugar mo bay.gusto ko din ssnang gawin yan sa probensya namin ipon muna ng puhonan

[@DextersWorld]

Kaya mo yan bong...

[@michelleanne7055]

Please share to us how do you clean the maternity cages? Thanks ☺️

[@Momshieann-18]

Nice business 🥰

[@LosInmortalesGallos]

How often do you remove the dirt from the maternal cages? And do they give birth on the plain dirt or do you provide some type of nest for the birth? Thank you.

[@stephenmaquimay3607]

Ang cute, gandang business ,damo lng puhunan , :)

[@papziegalicia2032]

Were are you gonna sell the harvested rabbits aside in your pet store sir dex..

[@profdapoet]

Thank you very much for your enlightening video, very crucial information - I am learning new things every time I watch your videos. Watching you from South Africa.

[@niluar1]

Where do you sell them

[@nashonrichards2972]

Great video dexter

[@aprilgopidolstvwonder6076]

Sir dexter, maybe your friend must try to keep them a distance of his rabbitry and geese n ducks.

[@estefaniamiranda60]

Gush...sana all kuya dexter.share k naman ng mga alaga u po.yan din po pinakadream ko ang magkaroon ng maramin alaga na pwede kong pakinabangan.pagkaperahan at magbigay ng kasiyahan sa akibg sarili at sa aking mga alaga na din.sa ngaun po alaga q ilang rabbit,manok,baboy at isang baka at kambing.gusto ko sana magkaroon ng gaya ng meron ka kuya na alaga...lalo na ung pabo at ganso😁...

[@parisbray2791]

Also have u thought about making compost pile using pallets in or outside of ur chicken coop then eventually open the pallets and let the chickens 🐓 scratch and eat all the bugs and worms in it ? I think it will help cut food cost tooo

[@L0_V]

Paris Bray , yes I thought and seen the same technique with pigs... pig manure left in a pile with a tarp over it and left for a few days... then the tarp is lifted and the chickens eat off the maggots and turn the manure into compost and the process is repeated in different piles around the property. Then when the maggots are almost all eaten throw a few hand fulls of worms into the manure and watch your compost ready for gardening.

[@murdellblack4611]

I love to watch your show, I remember when you only started with Chickens.I would love to visit your country and enjoy your farming. I am in the USA, I have a few friends in the Philippines nice people.

[@PrincestonTheFrenchBulldog]

If you were smart you’d plant mosquitoes plant around pen to keep bugs away

[@King-oo9ei]

kzbin.info/www/bejne/gmimf3VqjKxnbNE

[@andriesputter1977]

Very good material thxs guys

[@الهيبةملاكالجبل]

كل عاطفة لم تخضع لضابط العقل فضررها أكثر من نفعها، وكل عقل لا يستمع لنداء القلب فإنه يقتل الروح.. فالعقل والقلب ما لم يتشاركا تصارعا، فهما كالعينين للبصر.. والحكيم من استضاء بهما معا.

[@kabossingvlog5997]

Boss Dexter maraming salamat sa pag bahagi..san location nyo boss,.subaybay ko po channel mo at isa po akung OFW dito sa Qatar..may balak na mag buo ng sariling rabbit farm.thank you for sharing boss..

[@jomztv9415]

I really miss my baby doe :( they passed away last month bcoz of that skin disease :(