Jeremiah 05 4 17 5 10 2012

  Рет қаралды 104,679

Shepherds Chapel Bible Studies

Shepherds Chapel Bible Studies

Күн бұрын

shepherds chapel. Jeremiah

Пікірлер: 154
@doreenadurham5544
@doreenadurham5544 Жыл бұрын
I will always be grateful to this great teacher
@anamossman3951
@anamossman3951 4 жыл бұрын
I thank God for providing such a good teacher for all of us.
@TeaTephiTrumpet777
@TeaTephiTrumpet777 8 жыл бұрын
I and my children fall asleep listening. My thought is that there is a unique peace to our souls in hearing the word of God that helps even a child that knows nothing of the cares of this world but whose subconscious knows the words of their Father in Heaven. He is the teacher to help us who have to have oil/the Word of God to make it all the way. It is rough out there. No place to be without faith in Christ and every word of our Heavenly Father to see us through to the next life never having betrayed him for a fake. Best teacher ever who teaches you how to think and learn for yourself. He teaches how to seek truth, how to go back and research true meaning, he sticks to scripture and crushes man's false traditions with facts, science, and 2nd,3rd witness scripture. The bible never contradicts. It's possible for translations to fail at truth and if you find something that does not make sense, look up the original meaning in a bible dictionary. All wisdom comes from God.
@LoveLove-ud1wg
@LoveLove-ud1wg 8 жыл бұрын
tell the truth
@dmcrorie777
@dmcrorie777 7 жыл бұрын
Tina Kanak I play shepherds chapel even when I am not home. So my dog even listens. I know that sounds crazy but nothing is stronger than the Word of God in your mind, body, soul and home.
@spencerhinds
@spencerhinds 6 жыл бұрын
Try grammar next time
@MM-zx3vf
@MM-zx3vf 5 жыл бұрын
@@spencerhinds try humility.
@bessiehackworth260
@bessiehackworth260 4 жыл бұрын
99
@vazquezraul84
@vazquezraul84 7 жыл бұрын
I pray to my Father in heaven as much as I can because if I live is thanks to my God in heaven,I'm a sinner because we all fall short before the Lord's eyes!
@JungleRane
@JungleRane 6 жыл бұрын
Our Father keeps all our prayers♡ We have been greatly blessed to have knowledge of the Truth of the most High!
@gregborg3790
@gregborg3790 5 жыл бұрын
Our father has a way to reach us to the truth THANK YOU LORD
@arlenegage9873
@arlenegage9873 5 жыл бұрын
Im thankful to hear Pastor teaching the Bible. There are times I fall into a peaceful sleep by his wonderful voice! I do not feel aweful, I take it as a Blessing, a relaxing of my troubled mind.
@Alphamales4Trump
@Alphamales4Trump 4 жыл бұрын
It's wonderful to have these priceless gems of Pastor Arnold Murray , His teachings live on .👍🏻
@Alphamales4Trump
@Alphamales4Trump 4 жыл бұрын
As we TRUST in the most HIGH we SEE and HEAR the TRUTH in Between The LIE'S simply from KNOWING TOMORROWS NEWSPAPER TODAY👍🏻 IN GOD WE TRUST 🌟🇺🇸🌟🖐🏻☝🏻🖐🏻🇺🇸🌟🇺🇸
@Blancanajera204
@Blancanajera204 4 жыл бұрын
I love Shepard's Chapel, this is my Church, Thank God for this ministry.🙏
@peggypatton9170
@peggypatton9170 5 жыл бұрын
This man taught me so much I been so miss led all my life I'm 40 yrs old and I'm so thankful found pastor Murry god be with all my brother sister see you guys in heaven.
@Ronda-ye5qv
@Ronda-ye5qv 8 ай бұрын
Qqqqq
@anisewestbrook2197
@anisewestbrook2197 4 жыл бұрын
OH HOW I WISHED THAT IVE HAD MET THIS BEAUTIFUL GENTLEMAN A TRUE PERSON OF CHRIST 🙏🏽🙏🏽♥️♥️♥️♥️♥️♥️
@darlenebaker8277
@darlenebaker8277 Жыл бұрын
Mr Arnold you and your son Dennis have taught me oh so much your such a blessing to me. May God bless you Mr Arnold and I know you are resting in peace.God bless you Mr Dennis and your still teaching me.
@JeanetteLiggins
@JeanetteLiggins Жыл бұрын
We're is your son id like listening to him to.
@bluezy1723
@bluezy1723 6 жыл бұрын
Chapter by chapter & verse by verse I Love it
@cynthiasettle2035
@cynthiasettle2035 6 жыл бұрын
Jeremiah lecture # 23 in depth bible study with Arnold Murray
@stevenwilliams2303
@stevenwilliams2303 4 ай бұрын
I miss the pastor. He helped me open my eyes. I'm stronger than ever key of David.
@jamesward2686
@jamesward2686 Жыл бұрын
I stopped and started listening one morning I thank God for pastor Murphy and shepherd's chapel
@rosaparkes
@rosaparkes 3 жыл бұрын
I REALLY MISS THIS MAN, A TRUE MAN OF GOD. BUT I KNOW HE IS WITH THE LORD JESUS CHRIST AND THAT MAKE ME FEEL HAPPY AMEN
@theword4501
@theword4501 6 жыл бұрын
Pastor Murray's teaching of God's word is breathtaking.
@dalegribble5661
@dalegribble5661 6 жыл бұрын
AGREED
@jacquelinedouglas3483
@jacquelinedouglas3483 5 жыл бұрын
I Love how Pastor Murray teachers straight from the Bible!
@Bkara588
@Bkara588 4 жыл бұрын
I’ve been watching shepherds chapel since 2000 ,I like that they read from the Bible and then explain what it means, this is a good way to study the Bible !
@kittykohrherr3825
@kittykohrherr3825 2 жыл бұрын
My dad and family Watching him since the late 80's
@harlanevans7165
@harlanevans7165 7 жыл бұрын
I thank my Father YHVH for my precious gift of Jesus Christ to o guided or goaded me to view me towards the Shepherds Chapel and seeing him and anointed from him. Love to you all who enjoy his teaching the pure words of Christ .
@JungleRane
@JungleRane 6 жыл бұрын
Every time I listen to the teachings of Pastor Arnold and Dennis Murray, I remind myself that we must live for God Almighty and do His Will; not our will. Far greater than personal preference and fulfillment Is Living For Our Father; Obeying His Commandments and repenting daily by praying to our Father who is righteous and fair
@dalegribble5661
@dalegribble5661 6 жыл бұрын
Love back at u!!🙏🙏🙏🙏💝💝💝
@roywolfe3084
@roywolfe3084 4 жыл бұрын
Do any of you believe in eternal security?Eph.1-5 Eph 1-13 Romans 9th chapter... been a student at the Chapel since early 80's. I have been. Studying with RC. Sproul lately
@jessicalichter7254
@jessicalichter7254 2 жыл бұрын
It's YAHWEH!! NOT! YAHAVA like Arnold murray was pronouncing it!
@allysoncollins9924
@allysoncollins9924 3 жыл бұрын
I Miss Pastor Arnold Murray and his teaching I still watch all the reruns Dennis Great too order the Companion Bible Love it 😀🙏
@ericrichardson3070
@ericrichardson3070 8 жыл бұрын
Pastor Murray is an ANOINTED MAN OF GOD who teaches the word of GOD with AUTHORITY. Pastor Murray, Sr. and Jr., Thank you so much for teaching ME THE TRUTH. We had to go with another cable provider and you're not on Comcast but I will stream you through my computer and watch you until I fall asleep and all night as I sleep. Thank you again for ALLOWING THE HOLY SPIRIT TO TEACH ME, GOD BLESS YOU AND YOUR MINISTRY, ERIC FROM MICHIGAN
@judithsanford8552
@judithsanford8552 7 жыл бұрын
Pastor Murray Sr and Jr have been my teachers for many years thank you for God's word daily Judith Ann Sanford Calimesa .ca
@peroxide8823
@peroxide8823 7 жыл бұрын
Judith Sanford Pastor Muarry past away in 2014 unfortunately
@abbieandemilie18
@abbieandemilie18 6 жыл бұрын
Same here
@JungleRane
@JungleRane 6 жыл бұрын
Amen to the truth of your comment* I feel the same way* Pastor Arnold Murray taught God's Word as it should be taught* He was *Anointed by Almighty God*
@JungleRane
@JungleRane 6 жыл бұрын
@@judithsanford8552 Sent forth by the most High God Almighty to teach the truth of His(God's living) word to this final generation
@harlanevans7165
@harlanevans7165 7 жыл бұрын
I hope you all stay strong in these trying times and keep the faith . With a blessed God and ministry keeping the faith should be easy and if God be for us who can be against us ? keep smiling beloved , we have the victory . Dennis thanks for the warm handshake when I visited years ago and I thanked your dad in prayer for anointing me . Your teaching has been such a blessing and I will let Christ thank you for that . Your friend Harlan
@rosalynnmcarthur7074
@rosalynnmcarthur7074 7 жыл бұрын
sanford and son
@harlanevans7165
@harlanevans7165 7 жыл бұрын
Olstein is a false profit
@dalegribble5661
@dalegribble5661 6 жыл бұрын
That was beautiful🙏💝
@dalegribble5661
@dalegribble5661 6 жыл бұрын
@@harlanevans7165 AMEN!!!!!
@fevans3261
@fevans3261 3 жыл бұрын
Cvc
@rosaparkes
@rosaparkes 3 жыл бұрын
THUS MAN FATHER MURRAY HELP ME TO UNDERSTAND MY BIBLE. I REALLY LOVE HIM, BUT I KNOW GOD LOVE HIM, MORE AND HE HAVE DONE HIS WORK HERE ON EARTH AMEN
@vazquezraul84
@vazquezraul84 7 жыл бұрын
prays the Lord my soul prays the Lord day and night in Jesus name amen!
@stevennunez4973
@stevennunez4973 3 жыл бұрын
Shout the WORD!; Of The LORD thy GOD. Save our souls and Save the DOG.!!
@michealsmith28
@michealsmith28 2 жыл бұрын
He is truly missed truest he was like a circuit dad thank God his sons pick up the metal and here we are.
@lindasain4662
@lindasain4662 3 жыл бұрын
I LOVE TO STUDY WITH SHEPHERDS CHAPEL. THEY DO A AWESOME JOB, GOD BLESS THEM. I LOVE GODS WORD.
@Calvuslamp
@Calvuslamp 5 ай бұрын
Thank you for posting this video. PABM ANOINTED OF YHVH ELOHIM ❤ Godspeed 😊
@ravenmoon1165
@ravenmoon1165 2 жыл бұрын
Ty so very much for preserving these very important teachings!!!
@JungleRane
@JungleRane 6 жыл бұрын
*Matthew **20:28** KJV* Even as the Son of man came not to be ministered unto, but to minister, and to give his life a ransom for many.
@dukeman7595
@dukeman7595 6 жыл бұрын
Fine Teacher and a man with commonsense.
@itiswellwithmySoul153
@itiswellwithmySoul153 5 жыл бұрын
Did u know this is not there official site? Go to Shepherds Chapel official site n see the ones that apply to right now, they have both Pastors as well hun 😊
@itiswellwithmySoul153
@itiswellwithmySoul153 5 жыл бұрын
@ArmorInPlace did u know this not their official site??? Go to Shepherds Chapel official site n see ones that apply to today n these times, bet u will not be disappointed hun, plz help spread the word, some videos have been altered, the ones others have uploaded n that don't play well I'd be weary of hun
@wessreynolds6046
@wessreynolds6046 8 жыл бұрын
our help comes from the lord.
@RebeccaBartlett-si2ou
@RebeccaBartlett-si2ou Жыл бұрын
I prayed to father. I have found a footprint in stone it is the exact same size as my foot . It is amazing. My memory is real! Glory to the Father the Glory to the King !
@dennisboyd1712
@dennisboyd1712 Жыл бұрын
AMEN Pastor teaching God's Word
@eaglewingsministries8571
@eaglewingsministries8571 7 жыл бұрын
Thank you Yeshua, Jesus!
@kaycorbett2091
@kaycorbett2091 4 жыл бұрын
Thank you for sharing the word of God, being strong in the word to give us peace in are heart, and standing firm what ever we go threw, and trust the Lord. have blessed day.
@richiehoward8200
@richiehoward8200 Жыл бұрын
I too have been mislead also about Revalations all my life. Pastor Murray has taught me and explained to me straight from GOD'S HOLY BIBLE. MAY GOD BLESS YOU ALL.
@bluesky6985
@bluesky6985 9 жыл бұрын
Most people can't understand the truth. No matter how simple you make it
@aldecastro6415
@aldecastro6415 8 жыл бұрын
stan gore
@bluesky6985
@bluesky6985 8 жыл бұрын
They've been blinded from above
@randybeitler9628
@randybeitler9628 Жыл бұрын
Thank You Father YHVH l Love You
@spar53
@spar53 2 жыл бұрын
Thank you lord help to be a watchman until you return in your Holy name Amen
@louisgrassia351
@louisgrassia351 7 ай бұрын
You must play Jesus. Ask him to save you. Repeat your sense amen❤
@sawlovesyou52
@sawlovesyou52 5 жыл бұрын
Battle Hymn .....Glory, Glory, Hallelujah ... Glory, Glory, Hallelujah ... glory, Glory, Hallelujah ... Father's / Christ Jesus's (His) truth is marching on !!!
@garysuplee5092
@garysuplee5092 Жыл бұрын
Here's me again Lord.
@louisgrassia5735
@louisgrassia5735 4 жыл бұрын
XOXO TOO. The TRUE GOD OF course. LOVE you. Father. AMEN
@RandyBeitler
@RandyBeitler 25 күн бұрын
Thank you Father YHVH For brother Arnold and Brother Dennis
@louisgrassia351
@louisgrassia351 7 ай бұрын
Do you have oil in your lamps? The knowledge of christ jesus the true god, I hope so❤❤
@johnniepegues305
@johnniepegues305 2 жыл бұрын
I love your Bible study I love to catch it early in the morning here in Indiana I also like that the church is in Arkansas that was my mom's Hometown and Forest City Arkansas so I feel connection so my question is about the Sabbath day is it Saturday is it Sunday and what does the Sabbath have to do with your connection to being saved I'm having this debate with my brother we were Christians growing up he was a deacon in the church and now he's studying under the Israelites and trying to get the rest of us to convert but I know what God has done for me and I'm not turning to Israelite
@cobbler1111
@cobbler1111 4 жыл бұрын
i miss you
@wildanimus2559
@wildanimus2559 2 жыл бұрын
I never met him, but he seemed like such a sweet man with a good heart for God. His son seems to be a good man as well.
@wessreynolds6046
@wessreynolds6046 8 жыл бұрын
way to tell the truth. Tina
@davidarchibald6729
@davidarchibald6729 Жыл бұрын
God bless
@nighthiker8872
@nighthiker8872 4 жыл бұрын
Great!.
@carolsnead6740
@carolsnead6740 2 жыл бұрын
Thank you may God bless yall
@BillieDean-x1m
@BillieDean-x1m Жыл бұрын
Pull those boot straps tight and kick some dragon and take some names God bless Dr Murray and family for teaching God's word 🙏 like it's supposed to be bless Shepherds 🙏 chapel and staff in the Anointed Bread of Life Jesus Christ our living water 💦🙏 Abba Father Amen!
@biblerecordingtencommandme7214
@biblerecordingtencommandme7214 Жыл бұрын
THANKYOUJESUSTHIERSOMANNYSUFFERINGSANDCANFEELTHIERSBEINGBULLYEDBYTHEBADOEOPLES
@johnniepegues305
@johnniepegues305 2 жыл бұрын
💗🙏💗🙏💗🙏💗🙏💗🙏
@paigehawkins1945
@paigehawkins1945 7 жыл бұрын
Jesus said," many shall come in my name and say (this is indeed Jesus)I am Jesus, and shall decieve many. If Jesus, having healed on the sabbath day in the presence of all the Jews,and they,in an uproar and in rage,wanting to have him put to death,and on more than one occasion did they this, then surely Paul,Peter,Stephen,John,Mark and the rest of his disciples, having taught the people in the presence of the Jews, and being accused of teaching the people against the law of Moses. Paul even being thrown in prison as well as Peter,and Stephen being stoned (acts), for preaching in the name of Jesus and agsinst circumcision,with not once being accused of teaching the people that the sabbath day was blotted out and that it's observance was transferred to Jesus becoming our sabbath and we are at liberty to forgo our Lords commandment. For I tell you this, you know not the masters voice,or else you would know these things. That there still remains a rest to the people of God. To those who keep his commandments and his testimony.
@itiswellwithmySoul153
@itiswellwithmySoul153 5 жыл бұрын
Did everyone subscribed know that this is not their official site??? Can go to official site n watch the ones that apply to today. Many have been altered. If satellite don't point at cross in sky n make it shine then they have been altered. I love both Pastor A. Murray and son Pastor Dennis Murray w all my heart n consider them my Pastors, don't think either one would like somebody starting their own Shepherds Chapel n know they wouldn't for sure when has been altered! Don't take my word for it check em out n see which one is set up for right now. God Bless ❤ Shepherds Chapel official site 👍
@itiswellwithmySoul153
@itiswellwithmySoul153 4 жыл бұрын
@@zumadale For Bible studies from Shepherd's Chapel official site are Studies that apply to the times we are in now, this site doesn't have their permission and is not the true site of Shepherd's Chapel, make sure you put official site behind the Shepherd's Chapel name and get the authentic site ~🙏💞🙏💞🙏💞🙏
@itiswellwithmySoul153
@itiswellwithmySoul153 4 жыл бұрын
@@zumadale I have seen changes made before so I no longer except the generic version, instead I go to Shepherd's Chapel official site, I advise others to do the same 💞 Prayers for you n yours 🙏💞🙏💞🙏
@wildanimus2559
@wildanimus2559 2 жыл бұрын
This is true. They don't mind if people use recordings for their own personal use, but if people try to make money off it---that's a problem.
@biblerecordingtencommandme7214
@biblerecordingtencommandme7214 2 жыл бұрын
#WHYDIDTHEYLIEABOUTALASKAANDTHEINNERPLANETFAMILYSHIDEFROMTHEHARRPWEATHERWEPONBYTHEPENTAGONWHYWASSECRETSOCIETYSSOEVILTOTHESIMPLEGIFLOFLIFEGODCREATEDUSTOGROWUPDOBEETERCARETAKINGTHENHOWEWHEREBORNINITWHENDECEVERSLIERSHIDETHETRUETHFORALLTOLERNHOWCANWEGROWBEINGTRICKED
@gretawagner4945
@gretawagner4945 3 жыл бұрын
❤🕊🙏
@garysuplee5092
@garysuplee5092 Жыл бұрын
🐦
@narrowpath2980
@narrowpath2980 7 жыл бұрын
DOES ANYONE KNOW WHERE THE ARK OF THE COVENANT IS TODAY ?
@boonykins3933
@boonykins3933 7 жыл бұрын
SUPAFREAK it is with our Father in heaven...
@joeywullis154
@joeywullis154 7 жыл бұрын
in heaven
@abbieandemilie18
@abbieandemilie18 6 жыл бұрын
I've studied with PAM for 8 years now and while i believe 98% of everything he preaches, i believe he is wrong about this. He says that its seen in Heaven...this is true cause The Ark was , like the Temple, was made after the ones in Heaven. The earlthy Ark was hidden in Zeddikiaha Cave by Jeremiah when Nebuchadnezzar built a siege wall around Jerusalem. This is backed up in The Apocraphra. I believe it was found in 1982 by Ron Wyatt. It was under the Crucifixion site in the Garden tomb. When the centurion stabbed Jesus in the side, blood and water came out, pouring down thru a crack and landed on THE MERCY SEAT, His blood (The Sacrificial Lamb) is over the Law, just like Moses AND later priests sprinkled sacrificed lambs blood on the mercy seat over the law. Forever making Jesus and His blood forever over the Law. It still rests in Jerusalem today. Just my beliefs
@theword4501
@theword4501 6 жыл бұрын
SUPAFREAK ... It is with God.
@theword4501
@theword4501 6 жыл бұрын
Brandy Kocincki The Word of God says it is in Heaven. You Either believe God...or you don't. The Ark of Gabriel... Or the box they found in Jerusalem was taken by the Muslim. Then taken to Antarctica...the best I have followed.
@biblerecordingtencommandme7214
@biblerecordingtencommandme7214 Жыл бұрын
THANKYOUELDERENOCHISEETHEMTOTALREWINSMORNINGJOEARAGENCESTENCHESUSALLTHANKYOUJESUSFORENOCHANDTHETIMETRAVELERSWEKICKSATENSDARTSBOOARAGONTHEDEVILANDTHIERMESSAMEN
@wellutopia2237
@wellutopia2237 Жыл бұрын
I need a question answered.
@jeanine9293
@jeanine9293 4 жыл бұрын
Right to try
@dominiquemd03
@dominiquemd03 7 жыл бұрын
Already
@mikefrady7965
@mikefrady7965 3 жыл бұрын
I would rather strictly keep to the scriptures on creation because there is no such thing as a lineage of people before Adam knew eve!!! They simply procreated Cain and Seth when Adam had more children sons and daughters alike!! This is what the word of God says and let every man that says different be a liar
@wildanimus2559
@wildanimus2559 2 жыл бұрын
Huh? I'm sorry, but I can't understand what you're saying. Can you try to rephrase so that I might understand what you mean?
@lastmanbreathing9319
@lastmanbreathing9319 6 жыл бұрын
28:56 they aid the enemy that's the USA
@sawlovesyou52
@sawlovesyou52 5 жыл бұрын
last man breathing .... Seems they have messed with the word for I cannot find that which I read many, many years ago. Daniel wrote, "in the days of the end there will be no wisdom in your governments."
@ratscats9456
@ratscats9456 3 жыл бұрын
Wondering what you think of this now days..
@fevans3261
@fevans3261 3 жыл бұрын
uuu-0
@mikefrady7965
@mikefrady7965 3 жыл бұрын
Once you’re a Marine you’re always a Marine??? This is far from the teaching of Paul who traded all of his credentials and thought of them as dung compared to knowing Christ Jesus alone in the power of his cross
@wildanimus2559
@wildanimus2559 2 жыл бұрын
That's just man made brainwashing garbage they do on our military.
@lindsaymarksmith.9122
@lindsaymarksmith.9122 3 жыл бұрын
Trump = Daniel 11 19. Biden = Daniel 11 20. Obama = Daniel 11 21. It is Revelation 17:10-11 KJV Trump=6th Biden=7th Obama=8th & of the 7 the 5th head and the 8th. I keep warning what the holy spirit said to me after I humbled my self even if it falls on deaf ears. This is not an opinion or interpretation the holy spirit said this him self after I humbled my self after what happened to my mum and dad believing as a child trusting God fully like a child does a parent and that small still voice the holy spirit answered me. Comment for the full post I cant post it 1st or YT will hide it. I need a comment to post it on so it can be seen.
@yh10359
@yh10359 3 жыл бұрын
Hello Sheperd Chapel, Lindsay and everyones here! Culculate the number of: D 0 n D r u m p f in Eng- G. Also Fred D...pf his father's name.
@lindsaymarksmith.9122
@lindsaymarksmith.9122 3 жыл бұрын
@@yh10359 So your saying the Holy Spirit is false and a liar no Obama is the man of sin not trump the Holy Spirit said this you want to blaspheme him that is on you.
@lindsaymarksmith.9122
@lindsaymarksmith.9122 3 жыл бұрын
@@yh10359 When you have a warning of things to come soon in the spirit from the Holy Spirit as a watchman you have to sound the alarm. Obama is the man of sin and is the 8th and of the 7, Daniel 11:21 and Revelation 17:11. Trump is the 6th and is the king that is and he is turning his face towards the fort of his own land and shall stumble and fall and not be found, Daniel 11:19 and Revelation 17:10. Biden is the 7th and shall only be in power a short time and will be known as a raiser of taxes, Daniel 11:20 and Revelation 17:10 he must continue a short space. This came to me in the spirit from the Holy Spirit when asking for discernment about Revelation 17:10-11 KJV in June 2020. I have tested the spirit and it is the Holy Spirit he has done so much in my life bringing me from the world and to Jesus and this is what the Holy Spirit said to me in my spirit when I came and asked God believing like a child trusts a parent fully and without question and in humbleness. Revelation 17:10-11 KJV And there are seven kings: five are fallen, and one is, and the other is not yet come; and when he cometh, he must continue a short space. And the beast that was, and is not, even he is the eighth, and is of the seven, and goeth into perdition. Donald Trump is the sixth king the one that is. And Trump is at the point in Daniel 11 19. Then he shall turn his face toward the fort of his own land: but he shall stumble and fall, and not be found. The other not yet come and is in for a short space is Joe Biden that is the raiser of taxes from Daniel 11 20. Then shall stand up in his estate a raiser of taxes in the glory of the kingdom: but within few days he shall be destroyed, neither in anger, nor in battle. Barack Obama is the eighth and he was of the previous kings before him and he is the person in Daniel 11 21. And in his estate shall stand up a vile person, to whom they shall not give the honour of the kingdom: but he shall come in peaceably, and obtain the kingdom by flatteries. Obama is that man of sin and this isn't my opinion or understanding I didn't even consider him I am just saying what came to me when I asked for discernment we will see the next USA president raise taxes and only in a short time. Obama will not be voted in "they shall not give the honour of the kingdom" but talk his way back into power "but he shall come in peaceably, and obtain the kingdom by flatteries.". Also people say but there are so many presidents how is Trump the 6th and I have said all I know is what I got in the spirit then I said to someone Ronald Reagan was the 1st to bring in noahide laws. Ronald Reagan was the 1st president to sign a proclamation 4921 saying that the noahide laws are the moral foundation of America's character, that the Noahide Laws are a moral code for all regardless of faith, and from that time all have signed these into law. If you count from Reagan to Trump then Trump is the 6th. Also Revelation 17:10 is meant to be known when it happens because it says "and one is" and that is present tense so that prophecy is to be known when the 6th leader is in power why else would Jesus give to John to use present tense in prophecy. The Holy Spirit said the one after Trump will be used by Obama to get back into power with flatteries and not being voted back into power. I do not know how this happens I am just saying what I got from the Holy Spirit. But there is one thing I seen recently. House Speaker Nancy Pelosi announcing legislation that would create a commission to allow Congress to intervene under the amendment and remove the president from executive duties. She said this is not for Trump but for presidents after Trump that are mentally or physically impaired. With this they can move power from a president that is not able to perform there duties and move it to another that is not the VP. This came to me in the spirit from the Holy Spirit and I have had other things happen in my life that I know was from the Holy Spirit. This is not my opinion or from my understanding I did not consider Obama before this or have him in mind and when I had this come to me I didn't even want to share it at 1st because I know what people are like. But when you see danger you must say and this is a warning of what is coming soon. Believe or don't but at least remember because it is coming soon and when you see know time is very short and we all need Jesus and he is coming. The "virus" looks like it is the strong delusion in all the world and something like that cant happen unless the restrainer is taken away from holding the evil back. I am saying this now as a warning of what is coming not even so I am believed but so when it happens people will know that it is true and if they are not saved will turn to Jesus and to everyone else will warn others that we are at the door and look at Daniel 7:25 "And he shall speak great words against the most High, and shall wear out the saints of the most High, and think to change times and laws: and they shall be given into his hand until a time and times and the dividing of time." The head that has a deadly wound is of the beast kingdom not the actual person. The 5th head that is Obama was and was in power as long as he should and should never be a head/leader/president again. it says "And I saw one of his heads as it were wounded to death" That doesn't say the head was wounded it is saying it was like it was wounded "as it were" That wound is the fact the head cant have power again but that 5th head that is Obama when he gets power back is the deadly wound being healed and he becomes the 8th and of the 7. Revelation 13:7 "And it was given unto him to make war with the saints, and to overcome them: and power was given him over all kindreds, and tongues, and nations." Daniel 11:33-35 "And they that understand among the people shall instruct many: yet they shall fall by the sword, and by flame, by captivity, and by spoil, many days. Now when they shall fall, they shall be holpen with a little help: but many shall cleave to them with flatteries. And some of them of understanding shall fall, to try them, and to purge, and to make them white, even to the time of the end: because it is yet for a time appointed.". The man of sin will have his time and he will overcome the believers and we that truly believe in Jesus are to be sheep to the slaughter and we need to no mater what happens stand for Jesus and not fall away. All heads accepted the Noahide laws from that small people that say they are the light of the world but reject Jesus with Reagan as the 1st making him the 1st head. 1st head Ronald Reagan, 2nd head George Bush, 3rd head Bill Clinton, 4th head George W. Bush, 5th head Barack Obama, 6th head Donald J. Trump, 7th head only in power a short time is Joseph R. Biden and the 8th head the last ever USA president is also the 5th head and of the 7 Barack Obama. This is what the Holy Spirit said to me after what happened to my mum and dad last year. I said at the start of the 1st lockdown with words that where not my own they would not last the lockdown I have had things come out my mouth from no place then happen since I was a child and other things and after they passed on I humbled my self asked God what I did and the Holy Spirit that small still voice answered me and said what he did and I was in shock. What he said is not from me I didn't think any of this before hand I am not an American and I don't care about politics but this is what he gave me and is not an opinion or interpretation. Obama will use Biden to talk his way back into power with flatteries and Obama having two terms made that like a deadly wound to that position of power he should not be a head/leader of the USA beast again but will be and when he does that is the deadly wound healed and the fifth seal will be opened and the trumpets will sound soon after.
@lindsaymarksmith.9122
@lindsaymarksmith.9122 3 жыл бұрын
@@yh10359 I had a narrow path experience when I was younger. I was walking home at night and looked up the road to my home and seen a gang of people. I seen in what I can only think was a vision that they where going to surround me and beat and kick me. So I looked and thought well there is the road on the left and right it would be longer but it is easier paths and I heard in my self a small still voice say if I did it would be worse for me and felt it would just be more pain but I could die if I did. So I said to my friend that was with me when we walk up this strait road to my home there people will surround me and said to him when they do he has to run to my home and tell my father. So we walked up and the surrounded me and my friend ran and they beat me and kicked me all over the pavement and into the middle of the road. But in the end my father came and the people ran off and he helped me back to my home. And I could not see at the time the prophetic meaning in all this. Going up the strait and narrow path if you stumble I will come and help you and not to turn to the left or right path because they are easier and will lead to death but I thank God for that day because it showed me he can use hard things for his good it changed me over time to seek him and I seen the message. So I thank God every day for his love and patience. After the lockdown in the UK stated I said an odd thing to my ex that my mum and dad would not last the lockdown. My mum and dad where okay and I was talking to my dad again I said an odd thing the last two times I talked to him that he had to turn the other cheek and forgive others before he "passes on" my dad said not to preach to him he would not listen and had bitterness for my ex partner. Then my mum got ill and went into hospital then when my mum was getting better he got ill and had to go into hospital. Then he died on the 10th of April then resurrection Sunday was on the 12th and then my mum died on the 14th all over Passover. I am still trying to deal with that with all the madness from the so called "virus". Point is I was saying thing from no place and this is not the 1st time it happened in my life. When I was 15 my dad told me to go to the shops so okay that should be okay I did that loads of times before the shop was right over the road to where we lived. This time I stopped and said to him out my mouth from no place if I go out I will be bottled. This went on a bit my dad didn't listen and I went out to the hop and coming back a group of guys got in front of me and one from behind me bottled me overt he head and I ran home. Now I have had times like that a couple of times just saying thing from no place and it happened. I had a dream once of a car crash where I lived as a child I seen a school and the shops next to it and flats. it disturbed me not like any dream I had and 3 days later a family member died in a car crash where I dreamed it happened. I am not saying any of this to puff my self up because I am not and it is hard talking about some of this but these thing I know was from the Holy Spirit not from me and turned me to Jesus and I just don't want people to be blind to what is coming. I was in a bad relationship my ex was paranoid would get physically and verbally violent if I seen any woman be it on TV or outside so I stopped watching TV haven't watched it since 2001 and I stopped even going out side because every time I did she would think I was looking at women it wasn't easy but I loved her and wanted to show her that well it didn't word it wasn't as bad but she still found excuses to get mad. So after about 13 years of this I couldn't take any more I was on my last strew and it says God will only give you what you can handle so I asked on my face in absolute faith for help. If I left my ex she would use my kids as weapons against me say I ran away and so on and I couldn't have my kids be used that way and knew the only thing that would set me free was if I found she was doing things behind my back so I asked God to set me free. Three days later my ex came up into the room and I said to her out of no place I know what you been doing on facebook. Now I don't know where that came from because I didn't have any idea at all but her face turned white and I was like what she did something. Then she said well you know now then we are over and she said that she was chatting another man up over facebook so I got what I prayed for a way out it wasn't nice and hard but I got free of a bad relationship and my kids where not used as weapons. When I eventually had a place to go and was going out I stopped and said to her from no place again she will never have another child. She is the type of woman that loves having babies and from that time on she has tried a lot but ever time she has miscarried. So this is just some of the thing but I will put the one that started to change me and turn me from the world and on the road to Jesus now. Coming to Jesus on my face after over 20 years of being in bondage to addition just like with my ex coming to Jesus in belief like a child trusting a parent in humbleness, meekness and tears truly believing fully on Jesus and not my self asking to be free from the bondage of addiction and then having that addiction just lifted off me with no withdrawals nothing just gone wasn't my power not believing on my self or trying to do strange things to make my self give it up. All I had to do was truly believe and have faith like a child in a parent and it is hard to get to that point as an adult but if you can and let all go and truly believe and trust Jesus fully he can do anything.
@lindsaymarksmith.9122
@lindsaymarksmith.9122 3 жыл бұрын
@@yh10359 And under this my old post to show you are in the 4th seal and at the door of the 5th seal that is the 3 and 1/2 years of persecution Daniel 7 25 said and is the 42 months that the believers that are the spiritual temple are trampled this is to refine them as silver and gold and is not wrath god is longsuffering and many need this to come truly to him then after the 3 and 1/2 years Obama gets the 6th seal when Jesus comes and give the world the wrath of God and gets his true people the born again believers living and dead and gathers them all and gives them new flesh as Ezekiel 37 said and they go into the promised 7th day of rest that last 1000 years that is the last day and at the end of that the last war of Gog and Magog. Revelation 20:8 King James Version 8 And shall go out to deceive the nations which are in the four quarters of the earth, Gog, and Magog, to gather them together to battle: the number of whom is as the sand of the sea. Then the judgment. Then the 8th day of new beginnings where there is a new heaven and new earth where there is no more death or sin and the believers are with Jesus forever. ------------------------------------------------- The four beasts are kingdoms the last world kingdoms in order there descriptions are given. The Lion is always been the symbol of the UK it also actual had it on all four then later on standing on two legs. As the white horse is went out conquering most of the world when it was the world power controlling a lot of the world. The Bear is and has been the symbol of Russia for a very long time as well and many know the Russian bear well and they are also known as the reds. The bear when it got up and devoured much flesh is when it when Communist and killed thousands upon thousand of people for its cause and most where Christian getting murdered and no one cares about that holocaust and it is known who the bolshevik are of you know the people that hate Jesus. The red horse what can I say o look its the reds and it has a sword and we know from the bible the prophetically a sword in words like the one out of Jesus's mouth or the one we need to have with the armour of God. There sword went into the world saying words on how then need to get rid of people and it ended up from words to killing a lot of people in its name. The leopard with the four wings of a fowl o look four wings what can it be a symbol of? Well why not look at the nation that had the world power after Russia. And we have Nazi Germany with its swastika "four wings" and its fast cat like attacking army that swiftly won wars and took a lot of the world. And we have the black horse and isn't the Nazi Germans well known for that colour during that time and do you remember that because of the war there was rationing all over the world. "A measure of wheat for a penny, and three measures of barley for a penny; and see thou hurt not the oil and the wine." That was the rationing during that time and they protected the vineyards to make sure the wine was okay because and army the size it had doesn't work unless there is drink to make the men happy does it. Remember the occupation of France and how that most of the resistance was using the vineyards because it was a safe place the Germans where protecting them. "Fourth beast, dreadful and terrible, and strong exceedingly; and it had great iron teeth: it devoured and brake in pieces, and stamped the residue with the feet of it: and it was diverse from all the beasts that were before it; and it had ten horns.". So what world power came after Nazi Germany? It was the good old USA. The same USA that clearly is known as a people of many nations a diverse kingdom. It goes it makes war devours and brakes kingdoms that it makes war with saying its doing to to help them or because they are the evil people when the people they attack are mostly not bothered before hand but I bet now they are angry with the USA killing there men women and kids. "I considered the horns, and, behold, there came up among them another little horn" During this time the place that was Palestine was taken and given to the people that say they are the light of the world but reject Jesus and in doing so reject God. That little horn speak things against the most high. Now we have the fourth horse "And I looked, and behold a pale horse: and his name that sat on him was Death, and Hell followed with him. And power was given unto them over the fourth part of the earth, to kill with sword, and with hunger, and with death, and with the beasts of the earth." This can only be the USA with it constant wars with the fourth part of the earth that being the middle east brings death to them and leaving hell every place it goes. The diverse beast has a mouth of a lion and the lion that is the UK mouth/language is English and the mouth/language of the USA is the same as the lion English. A thing that was then was not and is again and rejected Jesus is not God's people they that do not have the son do not have God. They that are of the flesh and where disowned cut out of the tree they say they are the light but reject the light that is Jesus. True born again Israel born again saved by adoption into the one saved people and have the promise not by flesh or blood but because of faith and grace in Jesus. Romans 9:8 KJV "That is, They which are the children of the flesh, these are not the children of God: but the children of the promise are counted for the seed." Physically born Israel vs spiritual born again Israel the older brother vs the younger brother. look at the the examples where older brother is not of God but the younger is like Cain and Able, Ishmael and Isaac, Esau and Jacob, The older and younger son from the parable of the prodigal son. the older is always jealous of the younger because the promise goes to the younger and the older hates the younger this is examples of physical Israel that rejects Jesus and born again believes that is spiritual Israel. There is the Israel that is above them that are in Jesus and the Israel in the world that is in bondage and is not saved. Physical Jesus rejecting Israel Babylon the whore on the back of the USA beast “And in her was found the blood of prophets, and of saints, and of all that were slain upon the earth.”
Revelation 22:1 (March 12, 2014) ~ Rebroadcast picking up at Revelation 22:1
1:01:00
Shepherds Chapel Bible Studies
Рет қаралды 117 М.
Jeremiah 2:1 - 2:24
58:31
The Shepherd's Chapel Official Channel
Рет қаралды 10 М.
-5+3은 뭔가요? 📚 #shorts
0:19
5 분 Tricks
Рет қаралды 13 МЛН
JISOO - ‘꽃(FLOWER)’ M/V
3:05
BLACKPINK
Рет қаралды 137 МЛН
Promises Remembered (March 17, 2014) ~ Rebroadcast on the topif of Promises Remembered
1:01:00
Shepherds Chapel Bible Studies
Рет қаралды 143 М.
Shepherd's Chapel ~ I Corinthians 2:1 - 2:16 ~ (2012)
1:01:00
Shepherds Chapel Bible Studies
Рет қаралды 44 М.
Revelation Chapter 13:17 (February 27, 2014) ~ Rebroadcast picking up at Revelation 13:17
1:01:00
Don't Be Afraid
2:27:55
YHVH Savior
Рет қаралды 223 М.
Revelation 17:1 (March 5, 2014) ~ Rebroadcast picking up at Revelation 17:1
1:01:00
Shepherds Chapel Bible Studies
Рет қаралды 131 М.
Psalms 74:7 - 75:10
58:31
The Shepherd's Chapel Official Channel
Рет қаралды 4,3 М.
Romans 1:1 to 1:32 ~ Rebroadcast beginning the book of Romans 1:1
1:01:00
Shepherds Chapel Bible Studies
Рет қаралды 103 М.
The Swarmers   PO 2011
1:01:00
Shepherds Chapel Bible Studies
Рет қаралды 231 М.
Walk Through Revelation Part 1
58:31
YHVH Savior
Рет қаралды 97 М.
-5+3은 뭔가요? 📚 #shorts
0:19
5 분 Tricks
Рет қаралды 13 МЛН