Lionheart 1990 Van Damme, 4k Editing Back to 80s,

  Рет қаралды 83,721,731

Back to the 80’s

Back to the 80’s

Күн бұрын

Пікірлер: 5 500
@backtothe80sreels
@backtothe80sreels 5 ай бұрын
LIONHEART 4K Full Film Amazon amzn.to/44V2ohD A woman hires a drifter as her guide through New Orleans in search of her father, who has gone missing. They discover a deadly game of cat and mouse behind his disappearance in the process. If you enjoyed this movie scene today please like and subscribe!
@BrahimKcgggghaysi
@BrahimKcgggghaysi 4 ай бұрын
🙀😭🖤🖤🖤🖤🥱🚫🙀🚫🚫🥳🙀🙀🚫🚫🚫🙀🚫🚫🙀🙀🙀🚫🚫🙀🖤🥱🙀🚫🚫🚫🖤🖤🖤🚫🖤🥱🙀🥱🥱🇹🇳🥱🥱🥱🙀🚫😭🚫🖤🖤🖤🖤🚫🥳🩵🫒🩵🩵🩵🩵
@BrahimKcgggghaysi
@BrahimKcgggghaysi 4 ай бұрын
👄🩷👄👄👄💜❤️🇱🇾🥻❤️🥻❤️🥻🥻❤️❤️🥻❤️❤️❤️🥻🥻❤️🇱🇾🥻🥻🥻🥻🥻🇻🇳🥻🥻🥻🇻🇳🥻🥻🇻🇳🥻🇻🇳🥻🥻🥻🥻🥻🇨🇮🥻🥻
@edwardkurbah7337
@edwardkurbah7337 4 ай бұрын
Me
@Ninhh_
@Ninhh_ 4 ай бұрын
Q1
@gabrielcuello8722
@gabrielcuello8722 3 ай бұрын
cualquiera lo que pusiste aca abajo esa es otra pelicula no lionheart
@therealtinytalk1009
@therealtinytalk1009 11 ай бұрын
Be nice if we could go back to the attitude of those days where everyone is not so dang sensitive! GOD BLESS ALL!
@InfamousB9
@InfamousB9 2 жыл бұрын
One of the greatest fights from '90 movie era,watched this movie probably about 500 times👊👊👊
@mr-345countryballs.argentina
@mr-345countryballs.argentina 6 ай бұрын
Whoo one of tegreatest of ❤para mis gystos👌la mejor👏Joan Cloude Van Damme👍👏👏👏
@elshod.lelkaran
@elshod.lelkaran 6 ай бұрын
Seks😂1ceks1 cekSşekks vertikal holatda ekanligini veks 3:25 3:27 3:28 ​@@mr-345countryballs.argentina
@QwetIuuu
@QwetIuuu 4 ай бұрын
مرحبا
@risefromyourpain
@risefromyourpain 3 ай бұрын
Agreed. The look in Atillas eyes when he swings that head butt
@FERARI1LAMBO1
@FERARI1LAMBO1 2 ай бұрын
Yyyhyhhjyjyjh😮😮😮😮😮😅😅😅😅😅😅😅😅😂😂😂
@maryvalentine2473
@maryvalentine2473 2 жыл бұрын
That was a beautiful Van Damme fight, killer takes all he showed him who's better.
@Абат-т4в
@Абат-т4в 5 ай бұрын
4
@GabrielMaldonado-of7ks
@GabrielMaldonado-of7ks Ай бұрын
Está película no me cansaré de verla nunca
@sylvesterehimen7267
@sylvesterehimen7267 4 ай бұрын
Scenes still brings tears. Van Damme is truly a legend who deserves his crown.
@hugoroldan-c5i
@hugoroldan-c5i 3 ай бұрын
Ya es leyenda❤
@user-uo5um5ss1u
@user-uo5um5ss1u Ай бұрын
wrong, r e t a r d. never made a decent movie in his life
@Haerinx87
@Haerinx87 2 жыл бұрын
Bloodsport and Lionheart are Van Dammes absolute best movies!! I could watch them 100 times.
@CJTranceAddiction
@CJTranceAddiction Жыл бұрын
You forgot Kickboxer....best training montage of all time! Well, along with Bloodsport.
@jvrm728
@jvrm728 7 ай бұрын
Universal soldier was good too
@JMGENTERPRISES
@JMGENTERPRISES 7 ай бұрын
I agree!
@LesterHernandez-ts6ls
@LesterHernandez-ts6ls 7 ай бұрын
Dododo
@NguessanModesteBossuho
@NguessanModesteBossuho 6 ай бұрын
My best cyborg
@shaktiyadav311
@shaktiyadav311 2 жыл бұрын
Van dam se 1 baar milna chahta tha ... Amazing fighter... Blood Sports,, Dubble Impect,, all movies Awesome... Love u forever
@РоманЕфимов-ф5д
@РоманЕфимов-ф5д 3 күн бұрын
Фуфло....
@JoseCastillo-ks7uy
@JoseCastillo-ks7uy 2 жыл бұрын
I remember being 12 years old watching all Van Damme movies
@hermosillo11
@hermosillo11 Жыл бұрын
It's not about who's the biggest, it's not about being the fastest, it's about what's in the spirit and in the heart. What you get out of your inner power. To be able to adapt to the situation and change strategies if necessary. Saw this movie as a teenager.
@jasonlee4267
@jasonlee4267 Жыл бұрын
its a film, this isnt possible in real life sorry to spoil it for you, having said that I like the idea of the underdog having such spirit, and these 80s and 90s flicks were so good.
@hermosillo11
@hermosillo11 Жыл бұрын
@@jasonlee4267 You haven't understood anything. No one is talking about reality versus film. Think before you post, boy.
@ZACHANDJACKSZACHSMAFIA
@ZACHANDJACKSZACHSMAFIA 4 ай бұрын
@@hermosillo11don't post idiotic things, both of you. Just enjoy the scene and get your time for embarrassment outside of the internet. Else you end up ruining your own life by worrying about the dumbest things like arguments on the internet. -Jack
@hermosillo11
@hermosillo11 4 ай бұрын
@@ZACHANDJACKSZACHSMAFIA When the discussion took place eight months ago, it's probably just silly to play police on the internet right now. If you have a hard time reading discussion there are other places than youtube for you.,
@SatanaS-ed8qv
@SatanaS-ed8qv Ай бұрын
NO!!! IS JUST A CHOREOGRAPHED SEQUENCE!!!! WHY YOU PEOPLE WATCH A DAM MOVIE AS IF IS A DOCUMENTARY????
@Ray-ml6iy
@Ray-ml6iy 2 жыл бұрын
I grew up watching Van Damme. Brings back good memories. 👍🏼👍🏼
@gafortheloveofgamenfilm1159
@gafortheloveofgamenfilm1159 2 жыл бұрын
Wrong BET!
@charlespancamo9771
@charlespancamo9771 2 жыл бұрын
man is he gonna KICK HIM? I bet he kicks him! Then I bet he does a bunch of slow motion moves that anybodys mother could telegraph! After that bet he jumps up and does a slow ass kick where he spreads his legs like a gay male cheerleader! SO BADASS!
@YonCel-nm6ke
@YonCel-nm6ke Жыл бұрын
Aquí bien gracias Quiero ir todos Quiero saber que todo bien activo y todos sabemos bien activo bien tranquilo cómo es Disculpe toda la molestia estamos ya acomodados de la mañana y somos
@rere5861
@rere5861 7 ай бұрын
If you still watch this, you never grew up.
@JMGENTERPRISES
@JMGENTERPRISES 7 ай бұрын
He will always be my hero! Muscles from Brussels bro!
@wallacegentry4085
@wallacegentry4085 Жыл бұрын
Harrison Page/Joshua is an incredible addition to this film. He did not bet against Lion because he saw him as weak. He bet against him to save his life, because he's been there about lies and such. This is friendship!!!
@kenb2671
@kenb2671 2 жыл бұрын
I love all of the Van Damme movies and have them on VHS and DVD. This one was great especially the ending.😊👍🏾
@walterkoziol3822
@walterkoziol3822 2 жыл бұрын
I especially love the ending of this one. Those two guys chasing after him to take him back to their country had a change of heart and took Damme home and let him stay with them.
@luciochoque8512
@luciochoque8512 2 жыл бұрын
.@@walterkoziol3822
@johair213deripuson8
@johair213deripuson8 2 жыл бұрын
@@walterkoziol3822 t5t4r
@walterkoziol3822
@walterkoziol3822 2 жыл бұрын
@@luciochoque8512 huh?
@walterkoziol3822
@walterkoziol3822 2 жыл бұрын
@@johair213deripuson8 huh?
@yasamabaks4903
@yasamabaks4903 Жыл бұрын
Van Damme Crazy Actor. From Turkey 🇹🇷
@straycat1674
@straycat1674 3 жыл бұрын
As an older gentleman, and aging martial artist I look at back at films like this and I can’t help but to think, God I actually miss these.
@oma_elite
@oma_elite 3 жыл бұрын
They had that inspiration factor that you just don't find much anymore. Another good one you should revisit is "Over the Top" if you like this film.
@straycat1674
@straycat1674 3 жыл бұрын
@@oma_elite love that one as well
@erichramone7812
@erichramone7812 3 жыл бұрын
I never realized how cheesy these were though. Bad acting, bad fake looking choreography. B level cinema all around. Plot line that is very long in the tooth, you know basically there following the original Rocky” movie. Van damm has too look in his inner most self too overcome adversity. He comes out strong, gets knocked down (many times), but somehow remembers his training or what his motivation is by again looking deep inside and then uses this to overcome his adversary. That’s every Rocky Movie, or 99% of all fighting movies ever.
@oma_elite
@oma_elite 3 жыл бұрын
@@erichramone7812 You may be right but I could never bring myself to say those things. 😅
@erichramone7812
@erichramone7812 3 жыл бұрын
@@oma_elite haha
@mexicanlord2934
@mexicanlord2934 3 жыл бұрын
My dad use to love this movies RIP DAD 1962 & 1999
@JonathanHebrews
@JonathanHebrews 8 ай бұрын
You had two dads? Lol
@EricMuhayeyesu-el6nm
@EricMuhayeyesu-el6nm 8 ай бұрын
Can you believe 😅
@DaveVsEvilDead
@DaveVsEvilDead 7 ай бұрын
@@JonathanHebrews dude show some respect, are you that stupid?
@kairatkudusov1566
@kairatkudusov1566 2 жыл бұрын
the best actors, from the legend, we loved his films, and waited patiently
@arockwood30
@arockwood30 5 ай бұрын
As a kid I watched all of Van Damme’s movies and was in awe of him. I met the man in real life. He is so cool and really a down-to-earth type of guy.
@kp8310
@kp8310 3 жыл бұрын
Those initial punches from Van Damme to start the fight would knock out about 99.9% of men.
@rowanparmiter7622
@rowanparmiter7622 3 жыл бұрын
Wrong!!! 99.6%
@emmanuelelismane206
@emmanuelelismane206 2 жыл бұрын
Hola
@koleszgdanska7149
@koleszgdanska7149 2 ай бұрын
Or as one WBC commentator said "A hit from any of these guys would send 99,9% of men to the shadow realm" 😂
@Bartizzle739
@Bartizzle739 3 жыл бұрын
No matter how many times i watch this film when he says “wrong bet…arhhh” gets me pumped every time lol
@Haerinx87
@Haerinx87 5 ай бұрын
My Favourite part is "we got him, we got him" as Van Damme is punching his face!!
@Cobra-gl7or
@Cobra-gl7or 3 жыл бұрын
One of my favorite childhood movies of the 1990s along with death warrant and hard target.
@rickyflinchum2909
@rickyflinchum2909 3 жыл бұрын
Hard target is still one of my favorite movies to this day.
@kristianspencer1978
@kristianspencer1978 3 жыл бұрын
Hard target was jcvds best film in my opinion.
@ailo8625
@ailo8625 5 күн бұрын
Stop Asking Who’s Still Watching! We Never Stop Watching To This MASTERPIECE!!-
@comelytravel
@comelytravel 2 жыл бұрын
I pray who ever sees this be successful in life ❤️ ❤️
@ericthathaisen1081
@ericthathaisen1081 Жыл бұрын
Amen
@Rayan-mx5qz
@Rayan-mx5qz Жыл бұрын
Ameen Ameen Ameen
@terminator33565
@terminator33565 11 ай бұрын
Amen
@jaimesolis6999
@jaimesolis6999 10 ай бұрын
Amen
@EliyasMbendana
@EliyasMbendana 9 ай бұрын
@alexferrier5732
@alexferrier5732 2 жыл бұрын
Van Damme, Stallone, Arnold: The trifecta of action movie stars from the 80s-90s, this dudes were my heroes when I was a child and I still thank them for the awesome memories of badass movies, I even got into martial arts and bodybuilding because of them. Good times.
@vandamme1535
@vandamme1535 2 жыл бұрын
👍👍👍👍👍
@Ayaanhuss9
@Ayaanhuss9 2 жыл бұрын
@Recite-God-Heal-Me-Create-Miracles don't die as a disbelievers
@Ayaanhuss9
@Ayaanhuss9 Жыл бұрын
@D Legionnaire who is your lord grave first question
@Ayaanhuss9
@Ayaanhuss9 Жыл бұрын
Who is your lord grave first question
@Ayaanhuss9
@Ayaanhuss9 Жыл бұрын
@@vandamme1535 who is your lord grave first question
@GetMotivated978
@GetMotivated978 Жыл бұрын
This used to be my favourite movie when I was growing up as a kid in the 90s and 00s. I owned it on VHS tape and used to watch it like 2-3 times a week. I miss those times!
@РустамАслануков
@РустамАслануков Жыл бұрын
Ftyuí
@kyronjames2857
@kyronjames2857 Жыл бұрын
Same man never beat these sorts classics 👌
@jacksonyorksher
@jacksonyorksher Жыл бұрын
大和ハウス工業 シーレックス テイケイ西日本 裏社会 広島県警察 公安警察 検察庁 草津病院
@TheGamingHarbinger
@TheGamingHarbinger Жыл бұрын
This and Bloodsport all day!
@ibrahim-nt4gs
@ibrahim-nt4gs Жыл бұрын
Bende defalarca izledim dostum
@diorgeridley9227
@diorgeridley9227 Жыл бұрын
Van-Damme é simplesmente Extraordinário, vindo de geração de grandes heróis do Cinema como: Schwarzenegger, Stallone, Lundgren e outros, e home em dia nem se fazem mais filmes com essa qualidade e expressão de realismo!!!
@aichaouedraogo567
@aichaouedraogo567 Жыл бұрын
Ako na
@aichaouedraogo567
@aichaouedraogo567 Жыл бұрын
Akona
@aichaouedraogo567
@aichaouedraogo567 Жыл бұрын
Akona
@DaliaArizala
@DaliaArizala Жыл бұрын
Bandan
@westyraviz
@westyraviz 2 жыл бұрын
That face Attila makes immediately after the stare down with Van Damme as he turns away from Van Damme is real professional acting. The bored expression says “Why is this puny guy that I’ll easily destroy wasting my precious time by challenging me?” Then that unimpressed fleeting glance that he again gives Van Damme as he takes off his jacket expecting to see fear and timidity in Van Damme’s eyes. He nailed it! It’s not often that actors in these sorts of movies capture emotions without uttering a word. Kudos to him on the great acting!
@gutterbois
@gutterbois 2 жыл бұрын
I know right he should have received an Oscar
@NaughtyNick5
@NaughtyNick5 2 жыл бұрын
He was actually a boxer
@picallo1
@picallo1 2 жыл бұрын
He's the brother of the guy with the beard whos chasing JCVD. Fun facts: Atilla also plays the guy from Mongolia in 'The Quest' and the guy with the beard plays the guy that Chong Li breaks his leg in 'Bloodsport' and Tong Po in KickBoxer. JCVD is very good friends with that family.
@Dildo_Gaggings
@Dildo_Gaggings 2 жыл бұрын
Channing Tatum did the remake of this movie in 2009
@picallo1
@picallo1 2 жыл бұрын
@@Dildo_Gaggings Fighting is not a remake of this.
@Harry_Eyeball
@Harry_Eyeball 2 жыл бұрын
Still feels great watching Van Damme in this, 20 + years later! This movie rocked my teen years!
@cotillion
@cotillion 2 жыл бұрын
30 years :D
@luciofernandezestevano5713
@luciofernandezestevano5713 2 жыл бұрын
Lcouvious
@Asiansxsymbol
@Asiansxsymbol Жыл бұрын
@@cotillion Technically, 30 years is still 20+. 😆
@Nick.Ackerman
@Nick.Ackerman 2 жыл бұрын
Anxious girl Big hulking bad guy Shredded van Damme Black guy friend It has all the essentials for a great 80s movie!
@rere5861
@rere5861 7 ай бұрын
You missed a cute baby girl.
@Roxana_Official
@Roxana_Official 4 ай бұрын
that was when back then blacks were good and well behaved
@БакытбекТуманбаев-в5е
@БакытбекТуманбаев-в5е 4 ай бұрын
Сколько пацанов после его фильмов пошли в спортзалы не пересчитать крепкого здоровья тебе брат ты всегда в наших сердцах
@louiefernandez3835
@louiefernandez3835 3 жыл бұрын
Excellent film clip::: Van Damne!!!
@jakobboller9445
@jakobboller9445 2 жыл бұрын
I just love the Van Damme fighting skills. Great fighter all time.
@WebgiroOficial
@WebgiroOficial 3 жыл бұрын
Van Damme forever 👏👍
@TheRanqee
@TheRanqee 3 жыл бұрын
No mercy
@zainabuhamisi6675
@zainabuhamisi6675 3 жыл бұрын
Very nice
@jordan366
@jordan366 10 ай бұрын
Estos eran PELÍCULAS!! Sin tantos efectos especiales. QUE ACTORES!!👏,
@richardfranco8861
@richardfranco8861 2 жыл бұрын
Respect to all the Van Damme fans out there. First film i watched was Cyborg followed by Awol and now have every film he's in. Awesome martial artist and brilliant actor.
@xenoverse6720
@xenoverse6720 2 жыл бұрын
Karaté tiger c'est le premier
@teamslaiyans3808
@teamslaiyans3808 2 жыл бұрын
Hell yeah ! CYBORG is my #1 movie from JCVD 🔥🔥🔥🔥💪🏽💪🏽💪🏽💪🏽💪🏽
@jhongucci
@jhongucci 2 жыл бұрын
Respeto
@bigc895
@bigc895 2 жыл бұрын
Yes let’s just pretend coked out Van Damm never was in that disgusting trash they called Streetfighter.
@hannahjackson7724
@hannahjackson7724 Жыл бұрын
Hi franco
@VainqueurRoy
@VainqueurRoy 3 жыл бұрын
When the instant replay and the slowmo kicks in, you know that jcvd gonna win 🧐😁
@redoneshows_3697
@redoneshows_3697 3 жыл бұрын
kzbin.info/www/bejne/boDQemeQl72DmdE
@beneditomendes5082
@beneditomendes5082 2 жыл бұрын
Que Bom gostei
@jimnguyen3481
@jimnguyen3481 2 жыл бұрын
Was I the only 1 to record all these on VHS in the 90s so I can watch them all over and over 😂. Good old days.
@dnosteelergang1398
@dnosteelergang1398 2 жыл бұрын
Nope! U wasn't!
@Cahn2126
@Cahn2126 2 жыл бұрын
Yeah sucked that we were recording the edited versions
@aichaouedraogo567
@aichaouedraogo567 Жыл бұрын
Akona
@siyabongamndzebele4964
@siyabongamndzebele4964 2 ай бұрын
Childhood was definitely awesome
@jamaalg9906
@jamaalg9906 3 жыл бұрын
Ahh using the wilder fighting style just block everything with your face. Majestic
@patrickjones8255
@patrickjones8255 3 жыл бұрын
From the school of Rocky
@DaveMoongazer
@DaveMoongazer 3 жыл бұрын
Like from Kung Pow: "My face to your knee technic. I bleed. That makes me the victor!"
@ludwiggraupe7571
@ludwiggraupe7571 2 жыл бұрын
@1 🙈😂🤣Bekommst du Watsche mit Fuß. 😅 Ja ja 😝
@DaveMoongazer
@DaveMoongazer 2 жыл бұрын
@1 🤣🤣🤣🤣🤣
@victorlexander7643
@victorlexander7643 2 жыл бұрын
This cracked me 🤣
@garyr7027
@garyr7027 2 жыл бұрын
Legend has it, those who bet the wrong way are still broke.
@spiderg7601
@spiderg7601 3 жыл бұрын
Man I remember these days..when movies were fun and exciting.. Bloodsport...Rambo...Conan..they sure don't make em like they use to
@paulpolpiboon9535
@paulpolpiboon9535 3 жыл бұрын
😔
@DashaTherionAlisaKseniaBrigade
@DashaTherionAlisaKseniaBrigade 3 жыл бұрын
Rocky 4
@aluisiorodrigues5684
@aluisiorodrigues5684 Жыл бұрын
Muito,bom
@vitoramaro8468
@vitoramaro8468 Жыл бұрын
​@@paulpolpiboon9535 de
@Papubob
@Papubob 9 ай бұрын
I grew up with Van Dame movies. My favorite actor still
@ryanstewart4811
@ryanstewart4811 2 жыл бұрын
This without a doubt is John Claude Van Damme's greatest 🎬 flick, Should have been a sequel.
@SGTJDerek
@SGTJDerek 2 жыл бұрын
I agree but I think it's underrated. Along with Desert Heat.
@Ant-speakingfacts
@Ant-speakingfacts 2 жыл бұрын
@@SGTJDerek it actually is underrated but good
@atranfanatic
@atranfanatic 6 ай бұрын
Legionairre was kind of a sequel in a way.
@brianticas7671
@brianticas7671 4 ай бұрын
Double impact and universal soldier was good too.
@CosmosProvider
@CosmosProvider 3 жыл бұрын
JC is always so over the top i can't help but love it.
@catsaregovernmentspies
@catsaregovernmentspies 3 жыл бұрын
I think that was part of the JCVD experience, lol
@sultaa86
@sultaa86 3 жыл бұрын
A Actor needs a Signature. Something he'll be knowen for for All time. And with JCVD it was his over dramatic yelling.
@timmyggztv
@timmyggztv 3 жыл бұрын
Great movie🔥🔥🔥
@amandankomo9320
@amandankomo9320 2 жыл бұрын
I miss the vibe that movies in the late 80s and early 90s had.those were the golden days in terms of music and movies.
@brianadams9535
@brianadams9535 29 күн бұрын
I was a senior in high school when I saw this still watch today
@Gumorisco11
@Gumorisco11 3 жыл бұрын
Todays kids will never how thrilling these movies were
@darrenrenshaw7558
@darrenrenshaw7558 3 жыл бұрын
Films I cud watch again an again, they don't even no who van damme is haha I've educated people who have film degrees 😅
@darrenrenshaw7558
@darrenrenshaw7558 3 жыл бұрын
@Tony Ojiambo I no mate , sad init 😢, not going to lie I do play ps4 from time to time, but play games that are more realistic an got a story to them , that fortnite to cartoony for me . I bin playing since ps1 days . Jason statham awesome actor though, lock stock springs to mind 👌
@oldfriend327
@oldfriend327 3 жыл бұрын
I've always loved Van Damme's movies, especially what I believe are referred to as "Direct To Home Video" movies. His movies have kept so many people company late at night at the end of a miserable work week. He really has made a great legacy of films. Very talented and disciplined martial artist and actor/producer for sure.
@dindjarin559
@dindjarin559 3 жыл бұрын
I agree with most of what you said... disciplined, not so much. He is very knowledgable of various forms, and is very capable. However, to be discplined, imo, means to also be able to fully control yourself when doing fight scenes so that you don't accidently break bones or otherwise legitimately injure your co workers. JCVD has had a reputation for years of going full strength and injuring co stars and stunt doubles alike. Many reports of times where he didn't NEED to make full force contact, but he did anyway. A lot of stunt doubles who have worked on sets with him in the past, refuse to do so a second movie with him starring because of it. That is my only critique of the man. He is very generous, humble, a good hearted person, and really good at what he does at making his characters authentic and relateable.
@juanmora2332
@juanmora2332 3 жыл бұрын
El me Jor de los mejores
@dindjarin559
@dindjarin559 3 жыл бұрын
@Eric MillerActually, Bruce slowed his moves down for the camera during filming, as well as to limit the force of impact during those fight scenes, so as not to hurt the people he was performing with. This shows great control and discipline. I am sure even then it was difficult for the stunt actors to keep up with him. He didn't do full speed full force impacts when making movies, though. Chan broke his own bones doing stunts. He didn't injure others with his moves during fight scenes, though. Jean, on the other hand, broke other people's bones accidently several times, while doing scenes and stunts in almost every movie he was in, reportedly. No doubt they all know their stuff, and have put their bodies through some seriously intense & dedicated training for many years, to get where they are and to be able to withstand the things they do. JCVD definitely has earned and deserves the recognition and acknowledgment of being in the same league and class as many of the greatest martial artists and action movie stars, imo. He has some insane physical abilities and conditioning that you don't see often. no doubt.
@timmyggztv
@timmyggztv 3 жыл бұрын
Great movie🔥🔥🔥
@yuriboyka8141
@yuriboyka8141 3 жыл бұрын
This is so fcking bad that its just funny 😂 thx for the 20 years from this to Undisputed 🙏🏻
@adanballeza1147
@adanballeza1147 3 жыл бұрын
This is one of the best jcvd fight scenes, and movies fights ever!!!👍👍👍
@lagb6803
@lagb6803 3 жыл бұрын
Van da me es mi favorito de los años 70 y 80 yo soy luis y tengo 10 años
@sharms888
@sharms888 3 жыл бұрын
No way, you can't beat Bloodsport !
@lagb6803
@lagb6803 3 жыл бұрын
Gracias por todo mi gente deje los en los comentarios
@FernandoSousa-rd6gk
@FernandoSousa-rd6gk Жыл бұрын
I even cheered like that the first time I watched it in the mid-2000s😅
@anthonyw.spears7601
@anthonyw.spears7601 3 жыл бұрын
Never get tired of this 🎥 it is a classic 🔥🔥🔥
@valvenator
@valvenator 3 жыл бұрын
Anyone else rootin' for the "bad guy" in this? He was actually the gentleman in the fight giving his opponent a chance to give in Van Damme just goes ballistic and comes after him when he's down and just don't stop to give the man a breather BTW I'm no fighter but seriously in real life most any one of those punches would have knocked the opponent out
@muchaari3019
@muchaari3019 3 жыл бұрын
Hg
@muchaari3019
@muchaari3019 3 жыл бұрын
Ik
@johnsuds3709
@johnsuds3709 2 жыл бұрын
Noticed that too. Class act professional. No hate, just business. Gets the job done ruthlessly and effeciently and yet, is not needlessly excessive.
@brandonjordan2516
@brandonjordan2516 3 жыл бұрын
Ah the 80s and early 90s movies.....where everybody could trade off taking 9,000 kicks and punches right to the face, ribs and legs and still stand to win a fight.
@antoinesubitlescoups338
@antoinesubitlescoups338 3 жыл бұрын
How come current movies are any different?
@brandonjordan2516
@brandonjordan2516 3 жыл бұрын
@@antoinesubitlescoups338 fight themed movies aren’t nearly as big as they used to be.
@oma_elite
@oma_elite 3 жыл бұрын
@@brandonjordan2516 Yea evil world, too many people will just shoot ya nowadays...plus with UFC then you probably don't hear about as much other underground stuff going on anymore like in Fight club or this movie Lionheart with the street fighting. It's a shame. Some of these films are truly classics.
@nicolekidman4644
@nicolekidman4644 3 жыл бұрын
Thanks for all the love and support. Seriously blown away by the love from all of you ❤Thank you all ❤️❤
@patbrennan6572
@patbrennan6572 3 жыл бұрын
Must have been the water I guess. LOL.
@pieproducer
@pieproducer 2 ай бұрын
Epic scenes love it
@garyarms9647
@garyarms9647 3 жыл бұрын
Still the only fight to date that you get to see the same punch or kick 20 times in a row before you see the next one. ; )
@АндрейС-я5я
@АндрейС-я5я 3 жыл бұрын
Платил рубль и смотрел фильм с гундосым переводом но сколько счастья!!!!!! Это личное мнение
@redoneshows_3697
@redoneshows_3697 3 жыл бұрын
kzbin.info/www/bejne/boDQemeQl72DmdE
@USA849
@USA849 3 жыл бұрын
Не только ты получал удовольствие от просмотра етих фильмов шасс одно спецификации
@АндрейС-я5я
@АндрейС-я5я 3 жыл бұрын
👍👍💪
@redoneshows_3697
@redoneshows_3697 3 жыл бұрын
@@АндрейС-я5я kzbin.info/www/bejne/bWOTfqNohs2Eobs
@straycatsanctuary3475
@straycatsanctuary3475 2 жыл бұрын
Absolute legend and one of my old time heroes. Love live JCVD🧿💜
@nelsonluis4847
@nelsonluis4847 6 ай бұрын
this is the best Van Damme movie ever. this scene was epic
@ryanmcleod6488
@ryanmcleod6488 3 жыл бұрын
I cried my eyes out at the end of the fight when his buddy bets against him then he still hugs him the only action movie I've ever had that level of emotional connection to the characters I think t2 that's it great movie wish I seen more like it but kind of glad I haven't makes this movie special long live jcvd
@vivaldolemos35
@vivaldolemos35 2 жыл бұрын
...
@brightloyec6500
@brightloyec6500 2 жыл бұрын
Hello, how are you doing during this Christmas period of time???
@brandonm8131
@brandonm8131 3 жыл бұрын
Its amazing how so many of his films are pretty much the exact same
@romino29
@romino29 3 жыл бұрын
Back then we liked it, now it looks sooo ridiculous 🙂
@Wolverines4ever-sl1js
@Wolverines4ever-sl1js 3 жыл бұрын
Yeah they are all garbage.
@MohammedSoipu
@MohammedSoipu Жыл бұрын
😊 0:52 you fine I am to the world in the same as you fine kafeholic and your working in this fruit of a great to see if I will get it was the India and your poem on parents to akl fruit and your Pisillapppismillamariamisquvaiseyourfriendisnotgoodyourfriendtoled10pophtomohamedsalakedseethatl00kedseeyouareanne0mesalakedyouaregoodfrintisn0tgp00dfrentm0hamedamgreeisn0tgoodfrientmyfacepookcanceledeletedisclocedfonishiamtoledturuplevememashallamariamisqvwiise 0:52 😊 0:52 0:52 I don't have this okay to me in this okay I am going out for a great day and your working hours 0:52
@naserabuward7194
@naserabuward7194 Жыл бұрын
🎉fine
@bigcatmark81474
@bigcatmark81474 3 жыл бұрын
this is a great movie. I saw this in theaters with my dad when I was younger. My aunt had come for a visit and she, my mom, my dad, and I all went. This is my FAVE JCVD movie b/c it felt the most "real" and had the most "heart."
@paolasarmientollerena9565
@paolasarmientollerena9565 3 жыл бұрын
anacondaz
@paolasarmientollerena9565
@paolasarmientollerena9565 3 жыл бұрын
fantasmas
@paolasarmientollerena9565
@paolasarmientollerena9565 3 жыл бұрын
m
@williammunny9916
@williammunny9916 3 жыл бұрын
*_John 8.31 Then Jesus said to those Jews who believed Him, “If you abide in My word, you are My disciples indeed. 32 And you shall know the truth, and the truth shall make you free.” 33 They answered Him, “We are Abraham’s descendants, and have never been in bondage to anyone. How can You say, ‘You will be made free’?” 34 Jesus answered them, “Most assuredly, I say to you, whoever commits sin is a slave of sin. 35 And a slave does not abide in the house forever, but a son abides forever. 36 Therefore if the Son makes you free, you shall be free indeed._* _Jesus Christ loves you. Only Jesus Christ saves. Repent and be saved. God bless you, and the grace of the Lord Jesus Christ, and the love of God, and the communion of the Holy Spirit be with you and your family._ ---
@КаменьДагестана
@КаменьДагестана Жыл бұрын
Он просто любил брата - которого потерял и хотел помочь его семье не смотря на преследование военными, и кровавый путь к успеху, настоящий герой💪
@rthurrabayev6971
@rthurrabayev6971 9 ай бұрын
Раньше в молодости этот фильм всех сводил с ума, но когда подрос то понял что это просто фильм для детей которые любят Смотреть как бьют по морде и нечего не происходит 😂
@ratapaga5963
@ratapaga5963 3 жыл бұрын
I like how in all of his movies they triple the hits!!
@ءءامس
@ءءامس 3 жыл бұрын
Gyg
@petrbenes127
@petrbenes127 3 жыл бұрын
😢❤Leon,mam na tenhle film krasne vzpominky i na tu dobu kdy to byla novinka🙂!
@giliardedelmondesdasilvade6405
@giliardedelmondesdasilvade6405 2 жыл бұрын
Záhe7ruivo c
@rafizsahveledov1372
@rafizsahveledov1372 2 жыл бұрын
I am a beautiful person. The only way to get the best of luck. I have a
@rafizsahveledov1372
@rafizsahveledov1372 2 жыл бұрын
Rit96
@calikat1751
@calikat1751 3 жыл бұрын
I wish this legacy will remain forever!!
@ZitaDavid-z7l
@ZitaDavid-z7l 9 ай бұрын
Respect pentru munca lui Vandame depusă este o legendă!
@Kai-yx1eb
@Kai-yx1eb 3 жыл бұрын
this movie was such a great memory from my childhood. no one will ever surpass Van Damme as the best action star.
@sureshbabu3498
@sureshbabu3498 3 жыл бұрын
👍
@undefeatableyt7
@undefeatableyt7 3 жыл бұрын
Ever heard about Arnold Schwarzenegger or Sylvester Stallone
@williammunny9916
@williammunny9916 3 жыл бұрын
*_John 8.31 Then Jesus said to those Jews who believed Him, “If you abide in My word, you are My disciples indeed. 32 And you shall know the truth, and the truth shall make you free.” 33 They answered Him, “We are Abraham’s descendants, and have never been in bondage to anyone. How can You say, ‘You will be made free’?” 34 Jesus answered them, “Most assuredly, I say to you, whoever commits sin is a slave of sin. 35 And a slave does not abide in the house forever, but a son abides forever. 36 Therefore if the Son makes you free, you shall be free indeed._* _Jesus Christ loves you. Only Jesus Christ saves. Repent and be saved. God bless you, and the grace of the Lord Jesus Christ, and the love of God, and the communion of the Holy Spirit be with you and your family._ ---
@alanbanaga4691
@alanbanaga4691 2 жыл бұрын
@@undefeatableyt7 uu777h
@undefeatableyt7
@undefeatableyt7 2 жыл бұрын
@@alanbanaga4691 wdym?
@McCorduRoy1972
@McCorduRoy1972 3 жыл бұрын
Love the the acting from Attilla and how he remembered his line Youhhhhhhh!!!!
@jaz.lamber2378
@jaz.lamber2378 3 жыл бұрын
kzbin.info/www/bejne/p3uVlJmMqKdoZqM
@viewmaster617
@viewmaster617 2 жыл бұрын
One of the most emotional fight scenes I ever watched
@taoufiklh297
@taoufiklh297 Жыл бұрын
👍👍
@maugrinder
@maugrinder 7 ай бұрын
😂😂😂😂
@Dav1d_Angel
@Dav1d_Angel 3 ай бұрын
I miss that kind of movies👍
@ilagandiafox5439
@ilagandiafox5439 3 жыл бұрын
I really love vandamme. Great actor n martial arts.
@jaredpadalecki2231
@jaredpadalecki2231 3 жыл бұрын
Net zien how are you
@jankurdi-dt5kt
@jankurdi-dt5kt 3 жыл бұрын
Helo😘😘😘😘
@thomassteve3069
@thomassteve3069 3 жыл бұрын
How are you!
@ilagandiafox5439
@ilagandiafox5439 3 жыл бұрын
doing good tnx
@maradona4569
@maradona4569 3 жыл бұрын
Ah le bon vieux temps ça me rappelle ma jeunesse Jean-Claude Vandamme merci mon frérot
@brandonmanuel4690
@brandonmanuel4690 2 жыл бұрын
Damn I love this VanDam this one hold a special place in my heart ❤
@antoanetamarinova5322
@antoanetamarinova5322 5 ай бұрын
Wann Dam ist eine von SCHÖNSTES Männern in die Welt! Viel Dank!
@squelch079
@squelch079 2 жыл бұрын
When Van dammes face is shaking you know the opponent is up for an ice cold can of ass whooping😄😄
@aleksey134rus7
@aleksey134rus7 3 жыл бұрын
Jean-Claude Van Damme, The Best! ✊🏻✊🏻✊🏻👊🏻👊🏻👊🏻
@samsonlawal8387
@samsonlawal8387 3 жыл бұрын
Hello
@aleksey134rus7
@aleksey134rus7 3 жыл бұрын
@@samsonlawal8387 Hello, my from Russia
@cowboysvstheworld3879
@cowboysvstheworld3879 3 жыл бұрын
I like how his buddy remains on the floor on his hands and knees threw out the entire fight. Like I'll be right here when ya get back bro 😆
@ucheuchendu6058
@ucheuchendu6058 3 жыл бұрын
the same buddy was telling him to give up
@camrdaddy1937
@camrdaddy1937 3 жыл бұрын
And bet against him
@dmitrik5658
@dmitrik5658 3 жыл бұрын
I find it emotionally consistent. He felt abased for betraying his only true friend. I like it
@robertveith6383
@robertveith6383 3 жыл бұрын
* throughout
@davidnjenga9440
@davidnjenga9440 3 жыл бұрын
Bad friend
@Mikey-no9eu
@Mikey-no9eu 3 ай бұрын
Vero , avevo anche io il poster di Van dammone in camera , i combattimenti erano belli in questi film/soundtrack/location top e lui una leggenda 90s. Grazie JVC ❤
@dannyellaboatboat
@dannyellaboatboat 3 жыл бұрын
Love this scene! Bro, you know you got your work cut out for you when your opponent casually rolls his shoulders as if he’s still warming up, after tanking your initial flurry of punches lol
@Bruce.-Wayne
@Bruce.-Wayne 2 жыл бұрын
Lol...I'd exit the ring immediately then
@dannyellaboatboat
@dannyellaboatboat 2 жыл бұрын
@@Bruce.-Wayne I would too, hahaha
@luciofernandezestevano5713
@luciofernandezestevano5713 2 жыл бұрын
Lcouvious
@dannyellaboatboat
@dannyellaboatboat 2 жыл бұрын
@@luciofernandezestevano5713 I’m sorry?
@josephcarl4167
@josephcarl4167 3 жыл бұрын
When you realize that Van Damme used the same actors for almost 90 percent of his villains in his movies... I always appreciated that
@sharms888
@sharms888 3 жыл бұрын
what ! like who ?
@danmccauley80
@danmccauley80 3 жыл бұрын
@@sharms888 well the bald foreign legion guy is tong po and atilla is the end guy from the quest
@nickb5891
@nickb5891 3 жыл бұрын
@@danmccauley80 the Mongolian fighter in The Quest right?
@danmccauley80
@danmccauley80 3 жыл бұрын
@@nickb5891 yeah that's the one
@taofeng718
@taofeng718 3 жыл бұрын
Let’s not forget about Bolo!
@supremozx1z110
@supremozx1z110 3 жыл бұрын
Thank you for sharing.this was my uncle favorite scene. RIP Agusto F..
@michaelandia3171
@michaelandia3171 Ай бұрын
Me always and forever!!! One of the best 80/90s actions ogs
@kpham8789
@kpham8789 3 жыл бұрын
Watching this guy's movies is like watching professional wrestling. He got his ass beat throughout the fight. And all of a sudden out of nowhere he got super human strength, came back and win the fight.
@sreejithdathan7087
@sreejithdathan7087 3 жыл бұрын
Movie name please
@robertolombardi3698
@robertolombardi3698 3 жыл бұрын
@@sreejithdathan7087 AWOL
@evilwarlockofchaos
@evilwarlockofchaos 3 жыл бұрын
Attila would have broken him in half if this had been real.
@kpham8789
@kpham8789 3 жыл бұрын
@@evilwarlockofchaos Half? He would broken him into 5
@kpham8789
@kpham8789 3 жыл бұрын
@@sreejithdathan7087 Lion heart
@jasonwilson290
@jasonwilson290 3 жыл бұрын
Movie that bring back so much good memories from a poor child hood in Jamaica.
@asjadali7426
@asjadali7426 3 жыл бұрын
They were best days
@vikramgupta1366
@vikramgupta1366 3 жыл бұрын
I have seen this many times. Best scene.
@garywagstaff8104
@garywagstaff8104 3 ай бұрын
Love these kind of van dam films they was the best 👌
@gdjaybee742
@gdjaybee742 3 жыл бұрын
The 10 year old me is like.. Best JVD movie ever.. The 40 year me is like... YEAH lets stand there find out who can take the most beating. NO DODGING! JUST TAKE EVERY PUNCH AND KICK.
@oma_elite
@oma_elite 3 жыл бұрын
Atilla was always toying his opponents, letting them get hits in earlier in the movie too. I'd like to think he underestimated the power Jean claude was coming with, with those fast kicks at the end once he got mad and made his last stand....but yea I do see what you mean. Still love this fight. These movies back then where inspirational.
@jameschesterton
@jameschesterton 3 жыл бұрын
That's a good point actually haha, kinda funny though.
@moshuhnanren5845
@moshuhnanren5845 3 жыл бұрын
Hey man nothing wrong with that lol they just did it cause its manly
@русАаарус
@русАаарус 3 жыл бұрын
@@oma_elite аитыс
@romino29
@romino29 3 жыл бұрын
Maybe it was their strategy, to wear down their opponent. Couldn't you see that those direct punches to the face did them almost no harm ? 😅
@user-wz3tg8il1j
@user-wz3tg8il1j 2 жыл бұрын
I had a fight exactly like that once, it was brutal. Exactly, except without all the kicking and punching, but otherwise exactly.
@احمدأبوالهول-ص2س
@احمدأبوالهول-ص2س 3 жыл бұрын
I love Damme's strong kicks. They are the key factor enabling him to beat his opponents!
@oma_elite
@oma_elite 3 жыл бұрын
Yep. It is already known that legs can produce more power than a punch, but it's harder to accurately kick somone in the head than to punch depending....but if you can get those legs up like that and fast and with accuracy then it could definitely be a advantage.
@giuseppebattagliese6424
@giuseppebattagliese6424 3 жыл бұрын
​@@oma_elite And this is the great martial arts fight (but I recommend the whole movie): kzbin.info/www/bejne/ZqfQiIZ6fMmBmM0
@МухаммадСаймродов
@МухаммадСаймродов 3 жыл бұрын
Што
@MrPAULONEAL
@MrPAULONEAL 3 жыл бұрын
And that he's the hero...
@brianticas7671
@brianticas7671 4 ай бұрын
90s actors were special man. Van damme, Sylvester Stallone, Arnold Schwarzenegger, bruce willis, and dolph Lundgren.
@garyluck4929
@garyluck4929 4 ай бұрын
Forgot about Chuck Norris 😊
@guardiandstroyer9120
@guardiandstroyer9120 3 жыл бұрын
Fun fact, the actor who plays Atilla(Abdel Qissi), is Tong Po(Michel Qissi) his brother.
@jayrod0603
@jayrod0603 3 жыл бұрын
Oh shit cool
@Christopher-o_O
@Christopher-o_O 3 жыл бұрын
@@jayrod0603 Yeah, Abdel plays the Mongol in Van Damme's "The Quest" as well. Van Damme is tight with that family, so they kept starring in his films. Michel Qissi was in Bloodsport as well for instance, most people didn't realise that... he plays the Brazilian dude, Paredes.
@danhiser4891
@danhiser4891 3 жыл бұрын
And he plays the big mongal in the movie quest
@guardiandstroyer9120
@guardiandstroyer9120 3 жыл бұрын
@@Christopher-o_O Actually that is very well known. Since Michel was his sparring partner for years. So like you said he kept using Abdel and Michel in his movies, but Atilla and Tong-Po were the biggest roles they could get. He also loved Bolo for Bloodsport and Double Impact, he has a great relationship with him as well.
@aliakauser4279
@aliakauser4279 2 жыл бұрын
Yes knew this since i was young very close all these guys ❤️
@markusmjoadorador1697
@markusmjoadorador1697 2 жыл бұрын
THE BEST VANDAME
@Macoers123
@Macoers123 2 жыл бұрын
" 50% off everything that comes in! Wrong Bet!!! " 🤯😡 👏👏👏 Best scene!
@eugeniedepagie5382
@eugeniedepagie5382 7 ай бұрын
Hij is geweldig onze Belgische held ! Respect
@TopFlightSecurity415
@TopFlightSecurity415 3 жыл бұрын
his best performance ...this last fight was so moving to me when i was younger
@alexanderchnsk
@alexanderchnsk 3 жыл бұрын
Cuando se peleaba por cosas por las que valía la pena pelear. Ahora las peleas que uno ve en las películas son por pura trivialidad.
@redoneshows_3697
@redoneshows_3697 3 жыл бұрын
kzbin.info/www/bejne/boDQemeQl72DmdE
@pazjusticaliberdade1166
@pazjusticaliberdade1166 3 жыл бұрын
S
@williammunny9916
@williammunny9916 3 жыл бұрын
*_John 8.31 Then Jesus said to those Jews who believed Him, “If you abide in My word, you are My disciples indeed. 32 And you shall know the truth, and the truth shall make you free.” 33 They answered Him, “We are Abraham’s descendants, and have never been in bondage to anyone. How can You say, ‘You will be made free’?” 34 Jesus answered them, “Most assuredly, I say to you, whoever commits sin is a slave of sin. 35 And a slave does not abide in the house forever, but a son abides forever. 36 Therefore if the Son makes you free, you shall be free indeed._* _Jesus Christ loves you. Only Jesus Christ saves. Repent and be saved. God bless you, and the grace of the Lord Jesus Christ, and the love of God, and the communion of the Holy Spirit be with you and your family._ ---
@tommylundin5115
@tommylundin5115 Жыл бұрын
Loved his movies and still does. Great fighting choreography
@taoufiklh297
@taoufiklh297 Жыл бұрын
👍👍👍👍👍
@BiramSenge
@BiramSenge Жыл бұрын
❤❤❤❤❤😢😢😢thank you ❤❤❤
@leadspot
@leadspot 2 жыл бұрын
this to me still is the best van damme movie, the class comment, the family theme, the survival theme and the weight of the fights, this movie has a lot of heart not just an action pack movie, I really love this movie
@MuhammadIsMuslim
@MuhammadIsMuslim 2 жыл бұрын
er sir, excuse me but... There was Kickboxer too
@megavolt67
@megavolt67 2 жыл бұрын
This movie has a lot of heart for sure. It's my second favorite of his after Bloodsport.
@soumenmitra1181
@soumenmitra1181 2 жыл бұрын
THERE ARE MANY ACTION HEROES BUT ONLY VANDAMME'S ACTION CONNECTS...IT TOUCHES HEART WITH EMOTION.
@luciofernandezestevano5713
@luciofernandezestevano5713 2 жыл бұрын
Lcouvious
@aissaouislimane1602
@aissaouislimane1602 Жыл бұрын
٦.
@aissaouislimane1602
@aissaouislimane1602 Жыл бұрын
١
@aissaouislimane1602
@aissaouislimane1602 Жыл бұрын
١١١
@CBPM_
@CBPM_ 2 жыл бұрын
"That dude's gonna kill yo ass! Don't you know that??" A line so good he got to say it three times in a row.
@mikeoxbig1978
@mikeoxbig1978 2 жыл бұрын
That dude's gonna kill yo ass! Don't you know that!?
@mikeoxbig1978
@mikeoxbig1978 2 жыл бұрын
That dude's gonna kill yo ass! Don't you know that!?
@gaiusjuliusceasar5180
@gaiusjuliusceasar5180 2 жыл бұрын
Me too: That Dude is Gonna Kill Ur Ass! Lion Heaaaartttt!
@stephenmaharaj5230
@stephenmaharaj5230 2 жыл бұрын
A line that brings back fond memories of Lincoln Osiris as played by the great Kirk Lazurus.
@juanarojas7174
@juanarojas7174 2 жыл бұрын
Sin duda la mejor película bravo
Kickboxer 1989 Van Damme, 4k Editing Back to 80s,
10:00
Back to the 80’s
Рет қаралды 32 МЛН
Scene in the diner | Universal Soldier
3:11
Flashback FM
Рет қаралды 74 МЛН
ТЮРЕМЩИК В БОКСЕ! #shorts
00:58
HARD_MMA
Рет қаралды 2,5 МЛН
Каха и лужа  #непосредственнокаха
00:15
Bloodsport 1988 Van Damme, 4k Editing Back to 80s,
9:56
Back to the 80’s
Рет қаралды 119 МЛН
Anybody seen Richie?
6:28
Neurotripsicks
Рет қаралды 34 МЛН
COMMANDO Clip - "Airplane" (1985) Arnold Schwarzenegger
5:21
JoBlo Movie Clips
Рет қаралды 6 МЛН
Дуэль Ахиллеса и Гектора (Achilles vs Hector)
4:52
My Happy Crypto
Рет қаралды 37 МЛН
El furor del dragón (1972)
9:22
Cine Video Maximo 4K
Рет қаралды 1 МЛН
Jean Claude Van Damme Hard Target 1993
4:55
thehabbofouad
Рет қаралды 34 МЛН
Ong Bak (2003) Tony Jaa Club Fight Scenes Audio Thai 1080p
6:56
Pharturnax
Рет қаралды 17 МЛН
FOREVER BUNNY
0:14
Natan por Aí
Рет қаралды 21 МЛН