Lunch Eating Show - 4 Eggs Curry With Rice , Potol Vaja, Jhinge Torkari, Daal & Papad

[@Villagewomenfishingchannel]

Everything looks good except the hygiene,, the way he fill rice into the bowl with the dirty hand even though there was already a bowl inside the rice to fill it

[@ekahamsiah6586]

Orang India paling menghargai makanan👍,buktinya sebanyak itu habis tak bersisa,makanan adalah rejeki.

[@pinewoods2247]

The state of that poor dog... it's heartbreaking. Please give some food to that starving little thing. :'( He feels hunger just the way you do.

[@joym323]

I am agree with you

[@jyotisingh0723]

That poor dog was staring right into the food's soul please give him some food too. I m curious that when he dip his hands in everything than why not in egg curry i mean when he is dipping in every curry then why not in egg?

[@retnoendah1837]

Penonton dari indonesia mnaaaa👍👍👍

[@riyaririyari3425]

Hadirrr 👍👍

[@dadancarut5615]

Hadiiiir

[@aloussigilles3439]

@@dadancarut5615 !

[@cintapamela375]

Ada

[@arifwijayarifai3615]

Gue berani adu sama mknan sekelas warteg . 😂

[@saltin1968]

Hi sir...look at back, a dog behind you...I thing the dog so hungry...pls give the dog some rice or egg.

[@redp00l29]

Feel sorry to see that thin dog, hopefully there are people who want to care, give a little food, God will always take care of you, poor dog. 😭😭

[@iamdanield]

So I am🐶🐶😢

[@roundingcorners]

@@iamdanield dont feel sorry, there's hundreds of thousands all over asia

[@MrBayudhono]

wow...gak mau kalah ama abangnya dong langsung ambil piring, nasi, sayur lodeh, ikan asin peda, sambel, lalap terong, ketimun, sama pete...

[@sisnanikkom6787]

keliatan nya enak, tapi kalo liat yang jualan serasa kenyang,,joroook

[@rama5645]

Mual langsung iya😂

[@reniputri8850]

Seharusnya yg penjual atau yg masak harus bersih pakaian,ini malah kotor

[@nakayamamandatte6118]

Itu ciri khasnya india..wkkwkkk

[@nakayamamandatte6118]

@@reniputri8850 itu yg bkin nikmat dn aziiibbb...wkkwkkkk Eh stelannya yutubernya india kaku bgt ya yg ini... kemeja rapi pake topi..kemejanya bekas stirka apa baju baru itu ya...hahahaaa

[@supriyanto9865]

Saya liat kaku pakai sendok ya, jadi semua d ambil dengan tangan, ... Tapi ini yg bikin saya suka nonton Chanel street food lndia, kayaknya lahab buanget... 😊😀🙏😀

[@kuningcilacapkuning7497]

Seneng lihatnya makanya selalu bersih piringnya jadi gak buang" makanan . ..👍

[@azadev]

Proses bikin nya juga "bersih"

[@v.a.pvlogger781]

please feed some food to that poor dog ,god bless you

[@henryguillen3823]

Jaaaaaaaa😁😁😁😁

[@jayampandian8640]

So kind heart more people will help animals

[@ManjuR535]

He eats for watching dogs

[@pamelafelita4086]

Ameenn

[@fillenwijaya1557]

Gbu

[@ikaqueen5522]

This traditional cooking but looks so yummy..??😊

[@mechanical3danimation527]

Right

[@ravishanker2024]

Yes we are proud of our eating style . We eat with our own hands , which has given by GOD

[@MrZen-lt2wk]

It's good... but the hand have to clean ... just clean

[@itzmichael-codm22]

Of course he wash his hands before eating but not showing here, its good to use hands for eating , you can eat a lot

[@shravanikumari6907]

Really your eating style is fab. I would love to see how u eat with spoons.... Haha

[@dungnguyen-ki4rl]

Có cái thìa, ko xúc cơm ăn, lại ấn tượng ăn bốc của Bạn, thật sự hài hước nhất, 🥴

[@civick2052287livecom]

Wow, he finished all that rice.

[@aryasetaadiwangsa4545]

Parah ngambil nasinya dirawu pake kokod... Sungguh menyenagkan gaes!

[@leahow1803]

Remember 🧼 wash your hands before EATING 🍽

[@kantawcanggih2159]

Luar biaso Semua Pencernaan Masyarakat India. 'HAND PROOF' & Large hull accommodated

[@salmanfarisi5479]

Awokwokkwk

[@aldihafid1425]

Kok pakai tangan bapak pas ngambil nasi untuk konsumen ... Hadeuh ... Alhamdulillah saya tinggal di Indonesia ,, melayani konsumen dengan adab yang baik

[@dickyhendrianto8385]

betul, wkwk

[@Kellyxaditya]

Padahal ada centong😂

[@erwinrommel1353]

Yo ngonon kui wes umum...mulesss

[@arbifirman]

Nama nya juga india cuk , sanitasi dan hygine disana masih kurang.

[@46betta77]

kalian tau apa yg tdak mereka makan????

[@marnitaria6791]

Makannya super super . I like it 👌👌👌👍👍👍

[@OpenBola]

*Yap indian... whatever the condition of your hand, it remains clean*

[@shellymed9727]

The comments were so funny my stomach hurts 🤣🤣. Indians have such a funny sense of humor😂😂. I loved it.

[@jeniee00]

Miso Hungree u r mistaken this is not in India..

[@tikamainawati2365]

Gua klu nonton kuliner india pasti langsung cari komentar indonesia ...

[@bentobento9431]

Selalu ada di mana" lur

[@irnalinda1102]

Sama😆😆

[@rerexaliada4250]

Iya pda sok bersih nanti gk mikir budaya mulut tingal nguap😎 negri plng bnyak netizen indonesia

[@greedybeefy565]

Yummy. Definitely would try. With a spoon tho

[@ogmr.molina3359]

JUST CAME ACROSS THIS VIDEO RIGHT NOW ON THE KZbin NEWSFEED!IM A NEW SUBSCRIBER TO YOUR CHANNEL sir,THE INDIA FOOD LOOKS DELICIOUS AND SCRUMPTIOUS MMMM😋 GOOD VIDEO 👍!ENOUGH SAID WITH RESPECT OG MR.MOLINA SAN DIEGO CALIFORNIA USA 619!👊💪

[@johannatrisurani-heine9746]

OG MR. Molina But their knowledge abbaut the hygiene is not enough for the bisnisfood. In this Snack bar (if I just in Indien i think iwill lost my weight ) I will not buy his food 🤔

[@johannatrisurani-heine9746]

OG MR. Molina I like Indien food but is not in Indien In the other countries like in Germany or in Malaysia because the gay has hygiene knowledge better 😻

[@reshmaangnoo3515]

Am from other country I only recommend shoot in such way that other people like the hygiene n cleaning of the place where the food is prepared.

[@faceyourfears5094]

I love how simple their lives is 😊

[@MohazABakar]

Now i know the meaning colour for india flag 🇮🇳.... Orange- Curry White- rice Green- Dhal/mint With papadom or cucumber in the middle.

[@indianvlogs6636]

You didn't know the meaning of India our nuclear bomb can destroy your country

[@MohazABakar]

@@indianvlogs6636 wowwwwwwww...okay im scared nowww....dont bomb me bachi...your car horn also can destroy people feelings.

[@ashokpawar5643]

@@MohazABakar klllkflgkglklksakashlllkakly'allllllglkatkkPSkllalkaldsaglsklakkalslsllkkalkgagslyoukjllakasllkjlklllkkyewaklllskkfalyewsllllkalakaklhaasklaallkllklllfalksalakaallasapfalalaapoollalaUKlglklaakkkaslllkfldkkflllladoslllllsklskklklkslklslkslllllalllssha

[@marbunx]

I prefer watching your videos than other Indian street food videos. Because your video shows that you enjoy the food. Whereas the other videos from the beginning to the end are only videos boring. I have become your subscriber

[@umpaituck9840]

Don't forget a dog behind you (he waiting for you to feed him he hope)

[@kristinaawt8253]

Tiap negara dan daerah punya adat istiadat masing masing..jd tdk perlulah yg lain menghujat...

[@bentobento9431]

Yo gak menghujad tapi istilahnya heran atao gumon aja kita kan jarang liat atao hampir semua yg di sajikan di negara kita itu tak seperti di sana jadi apa kalo kita cuma heran itu menghujad

[@sasmitajena1039]

Eat only home cooked food. Hygiene and test better than this type of hotel

[@mrunalinagmote8062]

So creative person 😎😎👏✌👌

[@NafStarasta]

RIP The Spoon 😖😖

[@bentobento9431]

Sapa seng mati kang

[@DANIKOEATS]

OMG mouth watering🤤

[@luigigunner]

So he's going to touch everything then stick his hand in the rice pot without washing? Oh hell no!!!!!!!!!

[@tyronegomez2660]

😁😁😁

[@deddy4581]

Good taste Amigo 😂

[@annidasyifaralubis6483]

😅😅😅

[@sarojapillay6217]

Hw can one person eat so much of food i can't eat more than i chapati am surprise to c him he finished all most u r gr8💪

[@windofthemoon9904]

.طريقة الطبخ واضح لذيذه لكن لو اكل منه متاكده راح اتسمم لان طريقة غرف الاكل و الاواني مو نظيفه للاسف 😂💕💕

[@خالدمحييالدين-و8و]

هادا عم ياكل عن لهند كلا يالذيذ يارايق

[@jugaldehuri1501]

@@خالدمحييالدين-و8و pl

[@yoe5221]

Indian food is lots of preparation.. I can't do that I want instant food😂

[@anggiesoebank9830]

tu tangan cuci gak brow🙈😫😄😄

[@bentobento9431]

😁😁😁 gx usah cuci tanggan ntar nggak asin kalo cuci tangan

[@cintapamela375]

Gk kyknya 😂

[@iipjunaedi9352]

Bekas cebok tadi

[@parulianlubis8802]

Kalau kuliner india ditayangkan tiada tandingan didunia, apa lagi tukang masaknya, sampai2 saya selalu lapar 😂 😅

[@ahmadjaha4607]

Bukan jadi lapar,tapi malah pengen muntah, apalagi liat yang masaknya dekil dekil ga pake baju lagi

[@ahmadjaha4607]

Bukan jadi lapar,tapi malah pengen muntah, apalagi liat yang masaknya dekil dekil ga pake baju lagi

[@MotoLicious23]

Dirty, he takes the rice with hand. Even a spoon there. 🤦

[@iamagenius6264]

Ah munafik luh

[@MotoLicious23]

@@iamagenius6264 munafik palalu.

[@bryanslifedumas-og2269]

hahaha

[@kimmaravilla7903]

Your dirtier, bitch!

[@msangelina3960]

U have to have strong immune system to eat in these countries...these people dont know what is hygiene, just looking at the videos makes you sick

[@wilsongamba4097]

That's true,,, and try to comment about hygiene and they will get mad.... this is really unbelievable

[@marconijrmangrobang5463]

Well.thats their culture...Eating that way is how they enjoy it....he really enjoy it....

[@suriyatibaharom9726]

My immune system not that strong...having bad stomach..when I'm in India...

[@mikitam.9078]

I like how he made the time and effort to plate your food to make it nice and presentable. He wanted to impress you. I thought it looked very nice!! The food looked good, wasn’t burned or didn’t look spoiled. I’ve watched other videos and they just throw the food on the plate any kind of way, but this gentleman truly made an effort 👍🏾👍🏾. Also where is the hotel location please??

[@sriichan4750]

Cepet bener makannya😭😭 itu ngambil nasi pake tangan pula😂😂

[@riksencool]

Bahkan di jalan raya yg sama sekali tidak macet pun, klakson masih sering terdengar

[@irawanlilik231]

Suda menjadi ci hasnya😂😂😂😂

[@heryanwari2485]

Mungkin suara klakson adalah hiburan mereka dalam berkendara, saling sapa antar pengemudi 😁

[@juraganngapak9002]

Ibarat makan tanpa bawang bombay kurang afdol kalau gak klakson wkwkkw

[@angelputri5292]

Bawang pun buat lalapan

[@donjuan3771]

😳😳😳...waow..waow..waow...what is this sterill..???

[@andrijacob502]

5.32 This is the best part ever... You are washing your hand or mixing the soup?

[@thewizard8212]

Finally someone uses spoon Yayyyy 👍👍👍

[@rrs1093]

Apa cm sy yg mikir kok penjual ama kokinya cm make kaos singlet aja apa keteknya kaga basa kmudian di lap make kain untuk ngelap tagan jg pantas nikmat jurus tangan tuhan 🤣🤣🤣

[@penasantari]

Wkwkwkwk.......bener gan gw juga mikir gtu...wkwkwk

[@caprime1055]

Jijik bangsat

[@sobrian7659]

MANTAP Caaaakkkk😀😀 LejjaaaaAAAAARRRR👍👌

[@mujiraharja6465]

The fried eggs are for the "gong" of the side dish. He really enjoys his lunch

[@pasarmalam6603]

😀😀😀😀ajur jum

[@avrossfishing8302]

Tinggal nonton aja kog.. Yg penting bukan kita yang makan😊

[@heraning809]

Bener.. tinggl nnton.. g suka lht yg kotor..biarkn sj..toh adat d India bgitu.. lgian mrk yg mkn..

[@masubhat7205]

He is putNg enaMoz..the wAy he eaTing suckS... kaLabaN dito...peaCe JAI METAL

[@jejedanendra6315]

Suka liatnya aja..klo suruh mkan.enggak dehhh

[@adebayu3046]

The power off sarung cap gajah duduk :v

[@salmanfarisi5479]

Asuw nyasar lo bangsat :v

[@tuan_q4]

Ada juga yg pake handuk😂

[@duniasungsang2395]

Very nice 😘😘😘

[@TastyTastyFood]

Street food recipe so very nice

[@MarcuzNistal]

Soo dirty eww Daria food only in india

[@chefpetet]

Heavy eating show 👍 Amazing

[@MattMJM08]

I can't keep my eyes off his shirt sleeve. Almost touch the curry.

[@bjaygurung562]

😂Was thinking the same

[@joelechenique8852]

@@bjaygurung562 me too.. hahaha

[@rahulshah4166]

yes...

[@ettanaabil9198]

The magical of touch, yummi

[@RamiinoTV]

Muke gila yg jualan , tangan pegang sana pegang sini , pegang makanan anjay 😂 bagi org sono sih vitamin kali 😆

[@agustinuspaembonan7352]

Hargai budaya orang.

[@eti_quettelovers7522]

Pakaian pun cm kaos dalam doank pasti nya keringat kemana mana😁😁

[@MrG-wq5pb]

That looks nice I'm hungry now

[@amisheaven7811]

Please give some food to that dog 🐕 also

[@NurdiansyahSamawa165]

hahahaha you can just..............

[@putraari-lu7ix]

You are very animal lover. You have a noble heart, greetings to you from Indonesia 🇮🇩🇮🇩

[@pedropedrito8174]

Dog in india .... bad chance ...

[@iamdanield]

Love india from🇮🇩👍

[@akbardharmawan5444]

Yeeaaa di balik kemewahan dan kemegahan film2 india di tv😁

[@sang8211]

Tôi thích ăn trứng

[@igamemey1343]

Di obok obok dagangan Di obok obok itu yg jual tangannya habis buat cebok Legit mas ya wkkwkwk

[@adeiva0125]

Awokawok ngakak

[@fausanriski1202]

hahhaha keren ini yg inda menurut hindu times

[@remodonawijaya9281]

Sa ae... Wkwkwkwkwk

[@igamemey1343]

kzbin.info/www/bejne/opDYq32AibuNh8k Yg doyan liat channel kuliner an Ini Ada Rekomendasi KOCAK 😆

[@muhammadirwan8250]

Itu lauk klo di jakarta utk 4-5 org.

[@damakamin157]

Lahap..gelojoh..perut boleh muat semua😆

[@irwansamosir8759]

Ini makan apa lg nguji kemampuan daya tahan tubuh terhadap bakteri yah??😅😅😅🙏🏽

[@rahmimiftahul8080]

Irwan Samosir setuju

[@abdulazismarhabib662]

Irwan samosir ngapain urusin orang India, kamu manusia gila urusan ya!!!

[@user-qe2zm1xd5k]

Где лошки, вилки? Ну ёмоё :). Приятного аппетита.

[@violasyahdiva6922]

Jorok tangan bekas garuk ketek.. Ngupil.. Di pake buat ambil nasi😆

[@srimaryati8505]

Tambah vitamin bro jiahahahaaaa

[@magicink99]

Bhai Tere anda curry me kida b fry krdiya usne , watch at 1:39 properly 😂😂

[@kamenlaidarx9697]

in this place, i only recommend the coca cola and why they all wearing singlet and sarong???

[@t-rekx]

Cba di indonesia, klo nasix segitu byk yah, auto laku keras tuh, di kalangan orng2 perantau hahaaaa

[@ugik8278]

klo ngambilnya pake tngan gitu emng msh mau...apa lgi diliat tangan bapaknya dilap2 sembarangan aja....pake singlet dekil pulak

[@ghalder1674]

Poor doggy got tired of waiting n slept

[@prabhakarreddy2906]

How dirty food making items and place hands iron knief all ingredents boxes are open

[@prabhakarreddy2906]

Any person creat the video first look the,place server hands clothes are very,bad

[@lit4960]

5:31 did he just wash his hand use that soup then put it on rice?

[@PORBIKULAMARA]

nice food... yummy...

[@hendybong9684]

Dari tangan sang kokilah, banyaknya vitamin dan protein

[@ghalder1674]

Poor dog waiting for his turn at the background

[@linayusof3938]

Tengok yang tukang masak nya pun dah x ada selera.agaknya 24 jam pakai kain je.baju ngan kainya pun berkarah2.selera pulak dia makan

[@ghalder1674]

@@linayusof3938 Can u translate in English

[@MsAnnas]

@@ghalder1674 she said that the chef are dirty

[@realindian8778]

Dada nice eatiñg show dada sachi nice foodaa

[@aniani3066]

Nguber pakai tangan,timpahin di atas nasi, ku pikir air kobokan buat cuci tangan, gk tanya mlh sup,,🥵🥵🥵

[@akbardharmawan5444]

Ahaha

[@arisenoy6484]

Wkwkwk,iya..ko sama..sy pikir air jg air kobokan

[@zaleetv4161]

Baju penjualnya keren banget

[@ariantoarie1346]

Cokk kemproh, badokane ngalah"no sapi

[@suwarnosuwarno9806]

Kuoprossss tenannnnn tangane mari nyekel upil 😘😘😘😘😘😘😘😘

[@warkopsanti4232]

pasti beraknya kga bisa di banjur karena kegedean haha ha week

[@geveto1]

Tai ne mesti gede gede

[@jowoilangjowone4392]

Ngiseng e mesti gegelen/dobolen kuwi siliete 🤣🙉

[@yoenikitchen3138]

pokoke hidupppp cekerrrrr.... kebayang WC nya kyk apa. liat badan orang2xnya aja udah kyk gitu wuekkkkkkkk

[@thewhiteplate9921]

Nice food and nice video...👍👍👍

[@aminahlombok9971]

Why look so derty then how about the food its not healty at all my god

[@mehvishasif9459]

Ya

[@belenbelenmixblogs8411]

Enjoy eating my dear friend..i love eat daal

[@myjmd0819]

spoon fork and knife must be so expensive in india..

[@saikatdebnath6756]

no we like to eat rice with hands not with spoon

[@duymanhvn]

@@saikatdebnath6756 people say you Indians mustn't eat rice with anything but hands because rice is created by Gods. And you want to show your respect to them. Is it true?

[@mobile8psr129]

Thanks God I'm stay inPhilippines....

[@ejsschannel4282]

🙄 ... Like really? Those foods are lot much better than pag pag in The Philippines. And don't forget about Balut.

[@mobile8psr129]

Then what's the problem ?balut pinoy

[@ejsschannel4282]

@@mobile8psr129 Balut, the most disgusting food on this entire world. Nobody want to eat that sh*tty food but Pinoys. Yiaksss ... 😜

[@mobile8psr129]

@@ejsschannel4282 God bless you

[@DIYADEBa]

Ata kthy Dada??

[@fisterrina]

una cocina realmente medieval. Es como volver al pasado.

[@ryanscofield6416]

Abs makan pd diare sminggu wkwkwk

[@mohsipdayatu9390]

btul bro lihat badanx sya mau🤮🤮

[@kukuhaditya1987]

Campur keringat 👍

[@michaeljonathan9588]

with hand for serving customer....thanks but no thanks

[@yoenikitchen3138]

and customer eat with hand and clean on his soup OMG.......

[@eikolucifer4039]

Yes, he has a spoon and still use his hand to eat... 😳😳😳

[@bujanglangsat1817]

Culture some country use the hand... But make sure wash before eat...

[@okooko2176]

Your dog is dying right behind you. I know it is your birthday probably but give some to your dog

[@kiranasari6618]

Waaadduuhhh,asal comot aza ga pake cuci tangan...#jorok ih😱

[@jinglebells705]

that guy is using his dirty hands to serve in plate....

[@aminahlombok9971]

Yeah thats true so they cloth also so derty man 🤢🤢🤢

[@aminahlombok9971]

If i eat maybe i will sick

[@aminahlombok9971]

@jonathan kayina there whole palace so derty how to eat the food i cant take it

[@aminahlombok9971]

He eat also never wash hand

[@SunShine-gn4vo]

@@aminahlombok9971 hey! U talk so much if u can't take it don't watch then

[@hendybong3064]

Mantul ( mantap betul ) 🤢🤢🤢🤢🤢