15 Years Old Hardworking Kid Selling FRENCH FRIES 🍟 Street Food Afghani Fries Recipe Making

[@aniketsharma7832]

Such a hygienic potato cutting area

[@andrewb.9815]

I mean my man is hustling and working with what he has got.

[@shahidkhan-xn2bs]

ALLAH pak apko kamyab Kary y apky piyary or masum s hath jo struggling m lagy hoy h Ameen

[@yommmrr]

I wish him the best in life. He has a good work ethic.

[@RashidaHussain]

Yes! He is doing very well at this. May God grant him more success. Thanks for the comment 👍

[@-Pawuloniasty-]

Ethic? Maybe. Hygiene is worse...

[@SpeedFreak999]

Who gives a shit he's just a 15 year old boy ​@@-Pawuloniasty-

[@Pneuma6969]

sorry but how delusioned are you? you know where he lives? like, what circumstances they have, and what possabilitys? like, its not europe, america or russia or whatever, its afghanistan and from what ive seen here is still 1000x better than in india. o​@@-Pawuloniasty-

[@eniuthegamer]

Respect for all hardworking boys in Afghanistan.

[@RashidaHussain]

Indeed! May Allah give him more success.

[@harukatakahashi8822]

How about Mexico?

[@z6aq708]

@@harukatakahashi8822fuck Mexico

[@HussainAhmed-h1k]

This isn't Afghanistan I think it's Pakistan the language is Urdu the car look familiar just so you know I live in Pakistan

[@AndyRich2022]

That is what I call a hard working young man I give him all the respect keep going bro make your family proud

[@brentschmogbert]

It’s a child and he should be in school

[@Highskill3r]

thats not a young man that is a child my friend.. why is he not in a school?

[@Dripikdrippydipsdropkicks]

M8 he's getting more life skills doing this than any school in his country, American or anywhere else for that matter ​@@brentschmogbert

[@joaofelipe5470]

I am Brazilian and Greetings For Afeghanistan People ! 👏👏👏👏👏

[@RashidaHussain]

Wow from Brazil! I'm glad to hear that. Thank you for your valuable comment 👍

[@RAWhyte]

This Kid has got skills and talent, Insha-Allah when the boy grows up he Runs a successful Restaurant Business !! 😇👏🏽

[@RashidaHussain]

Indeed! I hope so. May Allah grant him success. Thank you for your valuable comment 👍

[@TheJono1170]

Haven’t got the skills of hygiene

[@DreamZeroYT]

@@TheJono1170 You can only comment but you Haven't got the skill of helping people

[@TheJono1170]

@@DreamZeroYT how am I supposed the help this prick

[@slaveoth5114]

Why saying Insha-Allah to an indian kid?

[@dorafurness466]

The container he is putting he fries in needs,a good scrubbing and never heard of putting flour on fries before. This young man knows what he's doing , hope he earns enough to help him and his family.

[@RashidaHussain]

Yes! He half-fries some fries, so when it's rush hour, he fries them whole, so that saves him time and the customers. He adds corn flour to make the fries crispy. May Allah give him more success. Thanks for the comment 👍

[@comicaiadventures]

WELL YOURE IGNORANT LOL

[@mahmoudsharif3864]

He adds corn flour to make it addictive and tasty so customers can come back all the time

[@tombruna4650]

Corn starch

[@mosaici.t.s8766]

Maybe not flour, but chipwhite.

[@queenelcene638]

He looks younger than 15... still, more power to him😊❤🎉❤ Blessings be😊

[@RashidaHussain]

Yeah right! May God grant him more success. Thank you for the comment 👍

[@LatishaHenderson-cy1vq]

etuivfdsdhjxnmmjvxsrteyiiiopufzsxmm🎉❤😢😢😢😮😮😅😅😊z fsdfvgb ..dgtrwesbhnhdszsfgghbn mxssddgtretyyuujolhssdffghhffffgv mmweewddgfhczxvbnmm🎉🎉🎉❤😢😢😮😮😅wrrrraaaaddffhghreeyynmkksaassdxxzzvvbbnn.mnsdghhjytewqqqwqassdfggfvxxvnnnvdazjnzxcvbbm🎉🎉❤😂🎉🎉🎉😢😢😮😮😮😅😅😊saddddddzghcxhhasxxcvvbddadrrrtyyyeeryuioadkjgfnn to wwqqssdasxxxdfggvbbxzmrhuujogfsghhjxc 2:29 vbnmrrretyaassdasqwwsddfgvzxcbn🎉🎉😢😢😮😮😅❤❤❤😂😂

[@LatishaHenderson-cy1vq]

xfgffv🎉🎉😢😢😮😮

[@Wazi-Azimi]

Such a hardworking boy.

[@RashidaHussain]

Yes! He is doing very well at this age.

[@Mr.FOODIE2001]

Salute to this child😢

[@RashidaHussain]

Yes! He is doing very well at this age.

[@libastonprograms]

Nice video. That’s really fun. Great cooking. Thank you for your sharing. Have a great day my friend

[@RashidaHussain]

I'm glad you liked the video! Yes, he is doing very well at this age. Thank you for your valuable comment 👍

[@4_4_4..]

ماشاء الله تبارك الرحمن.. سيكبر رجلا حقيقيا أسأل الله تعالى أن يوسع رزقه🇵🇸💚

[@DreadWing7777]

🙏A.M.E.N🙏

[@nopelindoputraperkasa5869]

Nice sharing Vidio..very inspiring and creatif.. good luck.. masyallah 🇮🇩🌺🌼👍👍

[@corneliuschew]

Definition of a true hustler 🔥🔥🔥💪🏻💪🏻💪🏻

[@TechLiberator]

So proud of these hardworking dedicated people. God bless.

[@eliseuoliveira2371]

Bom dia,tiro o chapéu pra o menino, como ele é muito trabalhador e inteligente, ele faz serviço de adulto 😮

[@GeofferyBlevins]

🍔🤔🍟🍕😊🌮🍚🤗🥢🥱👛 8:50 I love it when y'all eating tha food! It makes me want to go travel there just to taste it yummy. Thanks you guys looks great keep up tha great work you guys.

[@RashidaHussain]

Wow! I'm glad you liked it. Very welcome and must try it. Thank you for watching and valuable comment 😇👍

[@axjacobsen295]

Enjoy your food poisoning

[@Rollin-With-Kirk]

mmmm Flies with some Fry's! Double protein yummmy.. Keep up the work..

[@Deniel_]

Very healthy environment for food making. 👍

[@drinkmorewater8791]

LOL 😂

[@icmpeko]

It's cool, man - you can see he uses plenty of delousing powder after cutting the potatoes 🤔💥🪰🪰💥

[@tommyhassan3545]

Strong hard working boy I hope he makes millions

[@RashidaHussain]

Hope so! Thank you for the comment 👍

[@DjWellDressedMan]

Economic Child Exploitation, a Child should be in School learning

[@Smilemery]

@@DjWellDressedMan Lamentablemente no todos los niños tienen esa oportunidad

[@harukatakahashi8822]

​@@Smilemery like mexican kids

[@まろまろパディントン]

美味しそうですね〜😋💕頑張って！

[@overlockmaschine]

He has to be in the school. Not at work

[@aymn-art546]

This is all because of the corrupt countries that waged war in their countries, such as America, France and Russia. They are the cause of chaos everywhere

[@uqiesyukri7282]

Haters

[@SDtraining627]

School makes you poor.

[@kakibesi7760]

today is holiday...maybe part time job..take it easy,dude

[@dktdc]

Since you’re so concerned about his education, maybe you should put up the money to make sure that he gets proper education. Otherwise, he doesn’t need career advice from somebody farting behind the keyboard.

[@TheKuolin]

Amazing Kid❤ .. Later will be success..❤

[@RashidaHussain]

Yes! He is doing very well at this age. InshaAllah! May God grant him more success.

[@reii8929]

The way he works is so efficient and got steady hands for such work and such his age

[@RashidaHussain]

Yeah right! He is doing very well at this age. May God grant him more success. Thanks for the comment 👍

[@AdrewMeyers]

very hardworking kid with crunchy and tasty fries keep up the good work son

[@tedbell4416]

Thanks dad

[@ChatoriAsiya]

Assalam u Alaikum bhai mai hamesha apki video sath jo add ate hey wo bhi dekhti hu Allah pak apko kamiyab karey Ameen

[@RolisHerbandez]

This kid is more grown than most grown folks nowadays 😒

[@anloff]

like he had any other choice.... be reapectful

[@mettekesdg1538]

Ah good thickness of the fries, and bakes them twice! This Belgian is proud!

[@edwardcastrillo6577]

Awesome talent ❤❤ done fullwatch your video. New friend here

[@Duwap1017]

went from 8 to 15 in 2 years .. amazing

[@deagle2yadome696]

what do you mean

[@sui9452]

🤣🤣

[@StreetFoodSection]

Hardworking and inspiring for others 😍

[@tedbell4416]

God bless the White man

[@poseidon9916]

Much love from Brazil

[@BryanLai999]

Good job kid . U selling food and always keep ur work station clean i love that !

[@talatsadique4242]

Hope one day you will become a millionaire ❤

[@queenelcene638]

Billionaire, 😮😮😮lol😊❤🎉❤

[@Jesse-Studio]

Yummy! I love french fries! 🥲👍💯

[@divyangkamble7918]

French fries along with french flies 😂

[@uqiesyukri7282]

Haters alert

[@tommyhassan3545]

Jealous mug

[@Varenozz]

useless kid in the family, u only can ask money to ur parent, candy boys 😂

[@CALILIFE8251]

Come on guys he’s just adding some humor 😂

[@14k46]

@@CALILIFE8251 lol

[@user-ry2cv9yb3y]

Hardworking is better than school 👺👍

[@mieszkowisniewski835]

Full of respect for this young man... hard work and pasion make him rich some day, i hope for that ;)

[@RashidaHussain]

I hope so! He is doing very well at this age. May God grant him more success. Thanks for the comment 👍

[@mieszkowisniewski835]

@@RashidaHussain welcome... Always I am full of respect for peoples who doing something good in their lives. In my opinion this boy is also a motivation for someone... Many thanks for this video

[@LostDeadSoul]

The 10 year old kid has worked him self to the bone, working 25 houres a day the last 15 years. Amazing.

[@Jhankiel]

Ese niño trabajando desde tan joven, será un hombre adulto de bien 😊👏

[@RashidaHussain]

¡Sí! Le va muy bien a esta edad. Que Dios le conceda más éxitos. Gracias por mirar, estad atentos para más vídeos callejeros.

[@макаркривоносов-з6ъ]

@@RashidaHussain ииииииииииииииии

[@thegeneralscience6040]

​@@RashidaHussain sir I'm from India I want that potato cutting machine and we can make

[@neguel1165]

And our children are so lazy to wake up in the morning to go to school.. ☹️.. those childs like him are real human with strength. Big respect

[@Gccgg-if2td]

Картошечка в условиях антисанитарии да на пальмовом масле, мм вкусно а!

[@Zadumych]

Зато сколько приправы летает мясной =)

[@Opandort]

Wish all the best for him. He was literally better than me when i was the same his age. 👏🏻

[@ChatoriAsiya]

Allah pak hamarey pakistan ke halat achey kar dey Ameen

[@kanaomar3375]

Our prayers are with you guys,insha Allah love from Kenya

[@ChatoriAsiya]

Thank you so much

[@biswajithalder8640]

One day he'll be a millionaire cause hardwork never waste. Love from India ❤🇮🇳

[@teslamodel3201]

Blenchod, Hardwork is different from Smartwork.

[@anthonyn9935]

Fries and flys

[@v.richard9993]

Seeing how food in china is made im glad this people earn their pay with honest work

[@bestkksser]

I pray whoever eyes catch this God give you the strength you need to overcome every battle your facing may the dark thoughts and overthinking,my be peace and calmness fill in your life🇧🇸❤️

[@Cristobal_300ZX]

Good work ethic and good food too! Kid works harder than most adults I know here in the USA. Humble beginnings... I wish him the best on his future!

[@RashidaHussain]

I'm glad to hear that! Yes, he is doing very well at this age. May God grant him more success. Thank you for your wishes and valuable comment, stay tuned 👍

[@jayjoshi479]

He has excellent work ethic he's an authentic young man.

[@dhruvp.r7609]

The way he working hard and motivated to his job I hope a good life for him I’m sure that will come fatser

[@nealwilliam]

0:12 His fast cut potato fries 🤔

[@joejohn7840]

Kid works harder then most Americans i know. Myself included.

[@thomasheise5112]

Einfach Klasse, dieser junge Mann hat eine große Zukunft vor sich. 👍❤️

[@a.Bit.of.Fried.Halloumi.Lovely]

great future yeah sure mate..😅

[@axjacobsen295]

Frittenkoch... Herr Heise, zu mehr haben Sie es scheinbar auch nicht gebracht.

[@thomasheise5112]

​@@axjacobsen295keine ahnung wo ihr problem liegt aber ich habe keines. :) Überall auf der Welt werden Pommes verkauft, ist das jetzt was schlimmes?

[@TWay-yf5zm]

Great future, ahahah

[@e9..]

اللهم بارك للفتى ووسع له ابواب رزقك يا ارحم الراحمين تحياتي للباكستان 🇸🇦

[@Pashtun.Taraki]

و الله يقوي المسلمين. لتحرير الأماكن المقدسة للمنافقين الإسلام

[@melissariosordaz9865]

QUE BUENO, LAS MOSCAS SON GRATIS

[@Goodbyemyfriend-vk9lo]

Keep Up The Good Work Brother 👍🏽

[@cristianetorchesenkavabata]

He is a beautiful boy and champion😊

[@RashidaHussain]

Yes! He is doing very well at this age. May God grant him more success. Thanks for the comment 👍

[@cristianetorchesenkavabata]

🥰

[@Nagamah25]

❤❤❤ keep doing nice boy keep going school two ❤❤❤ bye

[@RashidaHussain]

Yes! He is doing very well at this age. May God grant him more success. Thanks for the comment 👍

[@antonioaguilar7542]

What is the white powder in the beginning?

[@RashidaHussain]

This is corn flour.

[@AramK]

Best of luck to this kid. Hope he will succeed in life.

[@gyaltsengoh1259]

He might succeed with a fast food chain

[@silmaradasilva1212]

Delícia batatas fritas, parabéns para o garotinho ele é muito habilidoso.🍟🍟🍟🍟😋👏👏👏🤗🇧🇷

[@RashidaHussain]

Sim! Ele está muito bem nessa idade e deixa as batatas fritas saborosas. Obrigado pelo seu valioso comentário. Fique ligado para mais vídeos de rua.

[@alexmonteiro4267]

Nunca vi tanta mosca....dá medo viu.

[@marcosgorreri8532]

E porco tambem

[@JohnnP7]

​@@alexmonteiro4267infelizmente lá é assim..

[@Paulatejando66]

Vai comer, de lá vc não volta kkkkk

[@justlilss]

This young chef boy is fascinating with his French Fries cooking, more later about his hardwork can relate on his own best. Love from Philippines

[@NazriB]

Lies again? Driver Chauffeur USD SGD

[@dkeditz771]

He faster than furious 😂

[@hasanalbannaelkirsh7748]

بسم الله ماشاء الله...دول اللى يعتمد عليهم

[@EtSlagFisse]

Humble humans. It's easy to take for granted what we have sometimes. Some kids these days already have ipads and computers as soon as they learn to walk.

[@RashidaHussain]

Indeed! Some get it without asking, some have to ask and some have to take it themselves.

[@LurkerDood]

Too many flies Someone buy the kid some fly zappers

[@LindaAucone-xb5in]

"I agree, french fries & free flies for that extra crunch!!!"😮😅😂😵🥴😆🤗🤭😛😝😜🤪🤔🤨😡🤬😤🥺😬🤐🤫🙁🤯😱😲😯😨😢😖😣😩😫😮‍💨😞🌚😵‍💫😵🤑🤢🤮🤒🤕🖤❤️🧕👳🙈🙊🍟⛑️🏥🆘❌

[@frankcarone6]

wow!!fantastic job ,hard working young man

[@brianb8498]

If he’s 15 than I was born on Mars

[@miragebangbravern]

In my school back when I was 15, everyone looked younger for their ages for the most part. It's not like in western countries where a 15 year old can look like someone in their early 20's.

[@Ayyyyeeeee]

I need one of these presses mounted in my kitchen lol

[@eddevil8317]

es la cocina más limpia que veo de todos, el niño es muy sistemático y dedicado a lo que hace.

[@RashidaHussain]

¡Sí claro! Le va muy bien a esta edad. Que Dios le conceda más éxitos. Gracias por mirar, estad atentos para más vídeos callejeros.

[@z-iroc9932]

Está llena de moscas seas mamon

[@zazouzaza7452]

SobhaAllah même des enfants valeureux qui travaillent vous les critiquez

[@RashidaHussain]

Oui! tu as raison. Ne vous concentrez pas sur les paroles des gens, c'est le travail des gens de dire.

[@uqiesyukri7282]

I will eat that..looks yummy..🤩

[@charlanetrapani30]

Beautiful Kid Send Me Some My Favorite Love California 💚❤️

[@andrewmoore7927]

Do the flies and black cooking oil cost extra?

[@AzilAmaar]

There is black oil in your local restaurant too loll go check behind the scene videos on youtube 😅

[@TWay-yf5zm]

​@@AzilAmaarstop defending that boy

[@86caw]

I`m a Chef from Switzerland. This its so impressive. . . simpel but soo delicious.

[@FPL_UPROAR]

flies included!

[@antoniacelestin8350]

My favourite food "Potato fries!"

[@GeneticXIV]

The bugs buzzing around make it look much more appetizing!

[@adnmrls6450]

Good job!! Some People say has to be in school.. but they don't live there. They don't even know what is happening in there

[@kamikasekase1422]

Welldone he already know how to survive at young age

[@RashidaHussain]

Yeah right! May God grant him more success. Thanks for the comment 👍

[@gyaltsengoh1259]

That looks much better than every fast food fries

[@wp2746]

Still better than at Burger King, well done. Love the Indians being frugal with their ingredients.

[@tedbell4416]

Nah burger king is better

[@feffy2149]

8:10 i thought the fly was another ingredient 😅

[@ЖекаЛ-у7о]

Антисанитария писец какая!!! Картоху с мухами я бы не стал пробовать

[@ownSystem]

One day this boy will own his own potato farm and empire :)

[@RashidaHussain]

Hope so! May God grant him more success. Thanks for the comment 👍

[@ownSystem]

@@RashidaHussain hes got the positive energy:) and can do spirit will become a true dream keep working and do great things :)

[@patrikbaldovsky4631]

hygiene -50%

[@WyattRyeSway]

That high?! Ummm…..

[@aryaa00anm]

Shut up. And i beleive you are white

[@ALI-zk7tg]

-10000⁰10000000000000000000

[@fungsia5549]

its the streets. what do you expect.

Wie du siehst mein lieber es ist unhygienisch! Aber das muss man auch akzeptieren dass das die Leute noch alle lebendig sind und es jeden Tag so weitergeht.

[@ChatoriAsiya]

Bhai kabhi hamari mobile shop per bhi aae hamey bohut khushi hogi

[@Alex-wi4wu]

Syf i bród nigdy bym tam nic nie zjadl😮

[@azunitedstates5615]

Exactly 😂

[@RashidaHussain]

Nikt nie prosi cię o jedzenie. Frytki są czyste i pyszne. Muszą tylko posprzątać to miejsce.

[@RashidaHussain]

@azunitedstates5615 No one is asking you to eat.

[@MarcinEasyRider]

Good job 👍😀

[@TheYoungSapling]

Very sad to see child labor hope this country can improve

[@ethanhall7314]

Respect! from US!

[@ownSystem]

Hope my likes are money to him and his family enjoy you guys earned it :)

[@RashidaHussain]

Hmm! May God give him more.

[@timo7259]

Hmmm fries with insects🤣

[@anthonyrodriguez3355]

Are you a male or female ? Straight or gay

[@TWay-yf5zm]

​@@anthonyrodriguez3355for what you need that information

[@menagoubran6080]

Some mock, others make.

[@yano9130]

😅😅😅😅​@@anthonyrodriguez3355

[@CuteRoblox_minsv8wt]

good work child❤

[@MD-hq7sb]

He is not 15 years old! At least 12! Whats wrong with this country?! United nations prohibited child labor! What a shame! This child should go to school or learn something! Dislike as always

[@uqiesyukri7282]

Haters alert

[@miragebangbravern]

1) He looks about 15 to me because that's like the average 15 year old I seen everywhere even back in school. It's not like you even look older straight away. 2) We don't know if he works every day or not and not everyone in Pakistan can go to school due to a lack of money. If anything, this at least teaches him great skills in life. 3) Shut the hell up.

[@fuzzy5987]

Education is a luxury when there's no food on the table. If he doesn't work they don't eat.

[@TWay-yf5zm]

​@@uqiesyukri7282chill kid

[@Givenchy-_-Dior]

ah yes, 15 years old kid is work very hard

[@RashidaHussain]

Yes! He is doing very well at this age. May God grant him more success.

[@eddiekang_95]

May Allah grant him prosperity. 🙏🏼