THIS IS THE SCARIEST FAZBEAR’S FRIGHTS EVER... FNAF The Horror Attraction by Battington

  Рет қаралды 154,202

Dawko

Dawko

2 ай бұрын

Leave a like if you enjoyed today's video! Lots of love!
• The Horror Attraction
Become a Dawkbro!
hex.store/
/ dawkosgames
/ dawkosgames
/ lewis_dawkins
USE CODE DAWKO AT GFUEL CHECKOUT FOR A DISCOUNT! gfuel.ly/31AcTEM
Discord: discordapp.com/invite/dawko
MERCH: dawko.teemill.com/
NINDAWKO - / @nindawko
Join this channel to get access to perks:
/ @dawko
#fivenightsatfreddys
#fnaf

Пікірлер: 717
@Battington
@Battington 2 ай бұрын
Thank you so much for the support! Big shout out to everyone who contributed to the video.
@Boigbauttp
@Boigbauttp 2 ай бұрын
Where is the behind the scenes
@amanammer
@amanammer 2 ай бұрын
everyone did an amazing job!
@graffivids2460
@graffivids2460 2 ай бұрын
Yes come on, how did Dawko not find and pin this?!
@MonkeyOnWheels72
@MonkeyOnWheels72 2 ай бұрын
Great job battington!
@yeahok8259
@yeahok8259 2 ай бұрын
Awesome work as usual man!
@feral0549
@feral0549 2 ай бұрын
Anyone notice when Phone Dude announced during the ride he mentioned a Code Yellow? That is typically for gas leaks or chemical spills. George could have been hallucinating the entire time, driving him mad until he eventually gets hit by the cart.
@corruption2681
@corruption2681 2 ай бұрын
Code yellow refers to a missing person, george was the corpse referred to at the beginning.
@corruption2681
@corruption2681 2 ай бұрын
He started existing out of time.
@aldiascholarofthefirstsin1051
@aldiascholarofthefirstsin1051 Ай бұрын
Don't spread misinformation.
@feral0549
@feral0549 Ай бұрын
@@aldiascholarofthefirstsin1051 Just a theory.
@aldiascholarofthefirstsin1051
@aldiascholarofthefirstsin1051 Ай бұрын
@@feral0549 It's not a theory, it's literally a wrong fact.
@Horroraddict666
@Horroraddict666 2 ай бұрын
maybe George was the "Dead person" that was rumored in the beginning by his friends, his soul was grounded there in that loop and basically in the beginning it actually happened before he died BUT when Vanessa was screaming for him, she was screaming for someone to help her because George died🤯
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
That could be. He could be assumed dead since they didnt find him. Kinda like no clipping.
@Horroraddict666
@Horroraddict666 2 ай бұрын
@@ParanoidHunters true!
@THICCsuki
@THICCsuki 2 ай бұрын
I like the theory, but what is understood was referring to Springtrap
@WildcatGambit
@WildcatGambit 2 ай бұрын
i rly like this idea, no wonder he couldn't go with his friends at the beginning!
@Horroraddict666
@Horroraddict666 2 ай бұрын
@@WildcatGambit thanks!🫶
@MoltenVR_
@MoltenVR_ 2 ай бұрын
Neat little fact, ever time George goes down the drop, the cameras time go's back too 24mins, indicating a potential loop in his mind, maybe because he may have passed out during the first malfunction. This can possibly be further proven when he says: "This most likely isn't real" Edit: The comments be wild
@Iguanodon-fb7rs
@Iguanodon-fb7rs 2 ай бұрын
lol Hazbin fan spotted
@1orenzius
@1orenzius 2 ай бұрын
"hell is forever whether u like ir or not" 🔥🔥
@Black_Gru
@Black_Gru 2 ай бұрын
Meh, Hazbin was completeley mid. The things that ruined it the most is the pacing and the kids watching it….
@Iguanodon-fb7rs
@Iguanodon-fb7rs 2 ай бұрын
@@Black_Gru I loved it
@SleepyKnight-sx7po
@SleepyKnight-sx7po 2 ай бұрын
Also his battery fills back up
@_shelby.mason_
@_shelby.mason_ 2 ай бұрын
"imagine the SMELL?! that's so DisGUstINg" with the voice had me so dead💀
@MrSprings355
@MrSprings355 2 ай бұрын
Like the way she said it had like sassy girl 2000s vibes
@jfdgbfjlttkntg
@jfdgbfjlttkntg 2 ай бұрын
i love it
@Frozzfire_Blackheart
@Frozzfire_Blackheart 2 ай бұрын
He sounds one of those tik tok material sassy gworl (even tho i dont like those people but i love how dawko just use that voice for out of context)
@HarmonyHowlette
@HarmonyHowlette 2 ай бұрын
Sounded like dawkos voice for Monika in his ddlc playthrough
@KingGodzillaTM
@KingGodzillaTM 2 ай бұрын
Valley girl accent yeah pff
@thefantasticretroreviewer3941
@thefantasticretroreviewer3941 2 ай бұрын
18:49, If I saw THAT freaky thing in the same spooky Hallway, I'd be so scare and run so fast that I would make Superman, The Flash, Road Runner, Speedy Gonzalas and Speed-Buggy look like slow Snails.
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
Just stay off the tracks you be good :)
@thefantasticretroreviewer3941
@thefantasticretroreviewer3941 2 ай бұрын
@@ParanoidHunters Seems like decent advice to me
@bbseal
@bbseal 2 ай бұрын
what about sonic
@thefantasticretroreviewer3941
@thefantasticretroreviewer3941 2 ай бұрын
@@bbseal Him too
@shadowphantom5407
@shadowphantom5407 2 ай бұрын
what about quick sliver?
@Immortal_Ninja
@Immortal_Ninja 2 ай бұрын
My guess is that George got stuck in a pocket of time after he got on the ride and thus time would naturally pass while George was stuck in the looping ride. By the time he "escaped", he was in the dead and dilapidated location that had been evacuated during a police investigation.
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
I think vanessa is some sort of trick as well.
@SymphonyOfTheMind.
@SymphonyOfTheMind. 2 ай бұрын
I thought this too, seems the most oogival
@MannequinMonarch
@MannequinMonarch 2 ай бұрын
That or he may have very well still been in some form of alternate reality or pocket location. I personally like to think about it like if FNaF had it’s own take on the Upside Down or Back Rooms. Entirely isolated, making it even scarier for anyone inside. Also means his body would NEVER be found, much like the poem in the original video’s description describes. Though that’s just my theory/head canon, I just like that idea as it is way more chilling and scary to me, the isolation and helplessness of it.
@bradley2468
@bradley2468 2 ай бұрын
This reminds me of into the pit
@kingcleeetus3587
@kingcleeetus3587 2 ай бұрын
Freddy Fastbear
@GooberProducer
@GooberProducer 2 ай бұрын
Fried rice at dennys
@whocaresaboutthename6850
@whocaresaboutthename6850 2 ай бұрын
Har har har har har har har (Green Hill Zone Theme).
@PurpleBoi69
@PurpleBoi69 2 ай бұрын
According to his Girlfriend
@izvayl
@izvayl 2 ай бұрын
@@PurpleBoi69hello
@THE_222
@THE_222 2 ай бұрын
@@GooberProduceris this where you wanna eat!
@JessRedMusic
@JessRedMusic 2 ай бұрын
The detail I love about this is when he goes into the drop, you can see the timer on the camera go back to the 20 minutes. To show that he did go back in time to relive the ride over and over and over again
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
I wonder how long he was there. Two - three hours?
@Candy_Kitsune
@Candy_Kitsune 2 ай бұрын
Feels like a reference to when you shoot Helpy in Foxys Pirate Adventure. It goes down a path that you're not meant to say and then goes back to the beginning
@Electricstarzsh0ckt0533m3
@Electricstarzsh0ckt0533m3 2 ай бұрын
The fact that it says “HurricaneHaunt”, it felt like it’s connected to the Novel trilogy
@thegodzillafandomsrookie5514
@thegodzillafandomsrookie5514 2 ай бұрын
or its just because both the series and games take place in hurricane utah
@MemeReviewer
@MemeReviewer 2 ай бұрын
Surprised Battington didn’t register a domain for that
@addison_v_ertisement1678
@addison_v_ertisement1678 2 ай бұрын
​@@MemeReviewerDomain Expansion: Hurricane Haunt.
@Reseptics
@Reseptics 2 ай бұрын
​@@addison_v_ertisement1678why does this actually go hard?
@MemeReviewer
@MemeReviewer 2 ай бұрын
@@addison_v_ertisement1678 yay!
@ElizabethLopez-un8ow
@ElizabethLopez-un8ow 2 ай бұрын
Out of all the vhs tapes this one was the most unsettling one too date
@Your_everyday_Weirdo667
@Your_everyday_Weirdo667 2 ай бұрын
Yeah,I couldn't even watch it on my own,it felt to unsettling to even watch on my own in the day,I only got as far as the third loop before I felt too unsettled to watch😅
@iimd_pll
@iimd_pll 2 ай бұрын
fr dude 😭idk why this one was just so scary, i had to keep pausing
@tm0410
@tm0410 2 ай бұрын
18:49 I love how this is a reference to golden freddys head in the hallway in fnaf 2, I remember being terrified the first time I saw that in fnaf 2
@kaIamos
@kaIamos 2 ай бұрын
Wait a minute, George's friends said a body was found on opening day. And we can tell that George is time travelling because of the time on the camera, so what if George was brought to the opening day and became the corpse found on opening day?
@anothernrg8274
@anothernrg8274 2 ай бұрын
Most likely, We NEED DAWKO TO SEE THIS, everyone, Like @kalamos 's comment!
@gamejitzu
@gamejitzu 2 ай бұрын
I haven't seen an idea like this, yeah it could've been really clever seeding. And if the black goop from Golden Freddy was agony, combined with time travel, this is like an Into the Pit situation Edit: oh :v
@Yayofangamer16
@Yayofangamer16 2 ай бұрын
The description of the video debunks this
@kaIamos
@kaIamos 2 ай бұрын
@@Yayofangamer16 Hence the what if.
@aldiascholarofthefirstsin1051
@aldiascholarofthefirstsin1051 Ай бұрын
@@kaIamos What if I made a theory that is completely wrong and then act like a coward when I face absolute facts that debunk it.
@sushifox0
@sushifox0 2 ай бұрын
My theory is that he DID go in, but the sort of “loop” that he was put in didn’t share the same time as the outside world. I could also see the use of illusion discs playing into this animation, but maybe I’m just yapping lmao
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
Somthing going on for sure cause that ride became somthing else.
@e-pointer2262
@e-pointer2262 2 ай бұрын
Nah illusion disks make sense unless the ride really does have a shtick of feeling like a loop
@lmaobox4068
@lmaobox4068 2 ай бұрын
It's good to note the areas that the giant golden Freddy head and black goop appear in are the only areas not affected by the building’s blackout Illusion disks deactivated in most of the building except for those areas explicitly with power?
@GlitchyBoy64
@GlitchyBoy64 2 ай бұрын
1:50 Dawko really went 😜💅👄💀 (The eyes in spring bonnie from the fazbrar frights logo send chills down my spine)
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
yeah it is crazy
@egg_head_defore
@egg_head_defore 2 ай бұрын
its a good design lol.
@THICCsuki
@THICCsuki 2 ай бұрын
I love that design too
@ashtrro
@ashtrro 2 ай бұрын
I genuinely felt this anxiety while watching this bc typically in horror it works best when you feel for the protagonist and he just did not deserve that lol
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
Yeah it gets worse and worse.
@kory_misun
@kory_misun 2 ай бұрын
Xander's voice acting was absolutely fantastic. I was genuinely afraid for him once things started twisting and becoming more dire.
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
It was very good. I thought the guy was a bit crazy but then im like yeah this is a bas situation.
@kory_misun
@kory_misun 2 ай бұрын
@@ParanoidHunters Yeah, we're not told how long he's stuck in there for. I'd become unhinged pretty quickly if I couldn't get out and no one came to find me. Meanwhile I know I'm not alone and the robots move.
@Jumpyman_thegamerYT
@Jumpyman_thegamerYT 2 ай бұрын
Notice that the time on the camera footage actually goes back each time. It keeps re-setting. This time just shows how long he's been recording for, and isn't what the time currently is obviously. Meaning that the time loop is physically altering the camera footage itself.
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
Yes and the power as well.
@giuliobros.123
@giuliobros.123 2 ай бұрын
Battington really knows how to make things terrifying
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
super terrifying
@kendgie_245
@kendgie_245 2 ай бұрын
When it said code yellow (aka, a missing person) I immediately was like, "Oh, George so got trapped in a time loop and is now missing"
@tristanribeiro7903
@tristanribeiro7903 2 ай бұрын
As I said in the comments from Batington's video, the concept could work as a potential new Fazbear Frights story : a loop where someone is stuck in an attraction, and can't escape. I love this video, Batington nailed it 👌
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
It was great. I would never go there lol
@tristanribeiro7903
@tristanribeiro7903 2 ай бұрын
​@@ParanoidHunters i mean, I'm sure that people are clever enough to avoid places like this for urbex.
@Marshmo
@Marshmo 2 ай бұрын
Battington never misses, I love videos like these
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
This one is so complex. Could start doing full movies soon.
@Crystal_959
@Crystal_959 2 ай бұрын
I don't think the protagonist was hallucinating. Every time George loops back to the start of the ride, the camera's display jumps back to how it was when he entered. We're watching through the camera's perspective, not George's. He got sucked into like, some weird pocket dimension or something. It states in the description that no one ever found him no matter how hard they searched
@pupulauls
@pupulauls 2 ай бұрын
Code yellow is typically a code for a missing person. George goes missing part way through the ride and is the reason it stops. The ghost of Springtrap somehow makes his body disappear while he torments him in a loop. He almost acts like Pennywise in this video, and spends most of the time making George more and more scared like the more fear he has the more satisfying the kill will be. Might be on purpose considering Georgie is probably the most famous victim of Pennywise. Also I love the big Golden Freddy head as a reference to FNaF 2 as well as the broken Toy Animatronics
@NekoPatty06
@NekoPatty06 2 ай бұрын
That giant head made me stay up all night because of how terrifying it was
@Cruisvfixz
@Cruisvfixz 2 ай бұрын
18:48 "You want fun?" "Fredbear will show you fun"
@Yumais
@Yumais 2 ай бұрын
Scott needs to hire Battington asap, his videos are just too well done and he's too talented to go unused.
@yeahok8259
@yeahok8259 2 ай бұрын
Yeah! And not even just because of his editing/modeling skills, but the dude is a very talented writer/director
@aldiascholarofthefirstsin1051
@aldiascholarofthefirstsin1051 Ай бұрын
Hire him for what? The video games are real time 3D, there is nothing Battington can do.
@Tarokun874
@Tarokun874 2 ай бұрын
21:13 George: WHY WONT YOU LET ME LEAVE springtrap: answer: ATZJDDKHTSKSKRGFHKWSHFKKHFKWWFSHRLHRSYRSRTSRHSRMYSHRS i mean he has a point
@Orange-inkling
@Orange-inkling 2 ай бұрын
Agreed
@Xzyzkw
@Xzyzkw 2 ай бұрын
At 16:07 you can see a shark animatronic at the right which I think is Felix the Shark which is a pretty cool easter egg
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
Thanks that was a cool find.
@Xzyzkw
@Xzyzkw 2 ай бұрын
@@ParanoidHuntersIt makes sense as well since presumably the SpringTrap used in the VHS was the one from the books.
@thundertits
@thundertits 2 ай бұрын
I like how this one felt like a fazbear frights books
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
It did.
@yeahok8259
@yeahok8259 2 ай бұрын
I commented the same thing on the OG vid! I wish more creators did stuff like this
@F1ZZYFAZZ
@F1ZZYFAZZ 2 ай бұрын
19:12 well,, Afton sure knows how to make a horrifying entrance 😭
@ThatTazVEVO
@ThatTazVEVO 2 ай бұрын
From what I think there are a few reasons to why the ride repeats and then kills George: 1. Springtrap uses the illusion disks to trick and alter Georges perception to make it feel like he's repeating the line over and over, which I think is cool because it turns Springtrap from a basic killer in suit to like a Mysterio from the Spider-Man comics; someone who can alter others perception with basic smoke and mirror tricks to twist their minds. Maybe William Afton sees Mike in George so that's why he hunts him. 2. It's the ghost of the children taking back the ride that makes fun of their deaths, which there are multiple references to previous VHS tapes that only Mike would've seen such as Chica's lovely song, Foxy meets the happy man & others. So imagine the hate the animatronics feel towards the ride that pokes fun at their death but then again why would they target George for no reason. 3. It's a farm for Remnant made by followers of William Afton. I'm saying this cuz there's references to Glitchtrap on the wall in the FNAF 2 room and one of the characters being named Vanessa. This is the most far fetched theory but imagine if followers of Glitchtrap created a harvester of Remnant (I have no idea how Remnant works I'm just guessing you get it via Monster's INC style but more people's death's not just their screams).
@aldiascholarofthefirstsin1051
@aldiascholarofthefirstsin1051 Ай бұрын
4. The yellow rabbit has reality altering powers, something that people really don't say for some reason, despite the other incredible parts of the story such as robots inhabited by ghosts.
@slimeezpizzeria
@slimeezpizzeria 2 ай бұрын
this is honestly my favorite fnaf vhs tape i’ve ever watched
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
This one had a lot going on.
@bubblepopva
@bubblepopva 2 ай бұрын
Thank you so much for reacting, Dawko! I had a blast voicing Vanessa and Jessica! ❤❤
@jakecookie5448
@jakecookie5448 2 ай бұрын
Being trapped in loop is something scary to be in especially when something alive in there while watching friends get killed in there😓
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
The guy is legit upset. I would be as well.
@JiggyThe1st
@JiggyThe1st 2 ай бұрын
1:50 Never knew I needed Zesty Dawko in my life
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
Zesty Pizza Dawko possibly?
@balls2132
@balls2132 2 ай бұрын
Dawko has a good voice impression 1:50
@SStickystickk
@SStickystickk 2 ай бұрын
“iMAgiNe the sMeLl, ItS DisGustiNG”
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
Or it smells like pizza
@AshishXMC
@AshishXMC 2 ай бұрын
The Huge Yellow Bear Head is basically me when I am about to have a bigger size of my favorite food.
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
And then a rabbit comes out? :D
@AshishXMC
@AshishXMC 2 ай бұрын
@@ParanoidHunters Yeah, I guess when I eat an egg sandwich, but they used boiled eggs, having no idea that whatever was forming inside before, was already formed.
@leonardoleal3526
@leonardoleal3526 2 ай бұрын
Oh my gosh. What a freaking animation, the sound, the animation, the ambient. Everything about this video is so creepy and so fnaf like. Props to battington and everyone who helped make this video.
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
They should start making full movies.
@leonardoleal3526
@leonardoleal3526 2 ай бұрын
@@ParanoidHuntersyeah that would be a awesome idea
@MikyYT
@MikyYT 2 ай бұрын
Springtrap really toyed with his pray
@thefantasticretroreviewer3941
@thefantasticretroreviewer3941 2 ай бұрын
Is it William Afton still stuck in that Suit?
@MikyYT
@MikyYT 2 ай бұрын
@@thefantasticretroreviewer3941 DUH
@thefantasticretroreviewer3941
@thefantasticretroreviewer3941 2 ай бұрын
@@MikyYT Just making sure.......and even in the Suit he is scary
@marcee1487
@marcee1487 2 ай бұрын
I didnt know afton was religous.
@DedBoyRyan
@DedBoyRyan 2 ай бұрын
@@marcee1487For real.
@bluegold1026
@bluegold1026 2 ай бұрын
Love all the callbacks to Battington's previous works. Also, the plot of "The Horror Attraction" would fit right in as a short story in a Fazbear Frights book.
@wafagdplqs4421
@wafagdplqs4421 2 ай бұрын
I always loved fans interpretation of Fazbear Frights because we've never much of the actual attraction in the games. And of course Battington would be perfect for this !
@NifftyTheKiller
@NifftyTheKiller 2 ай бұрын
i love how dawko said “tHeReS ya WaRnInG 😂😂😂 dawko is the absolute best person i really hope he gets invited to the fnaf 2 movie set he deserves it 🩷🩷🩷
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
If 2 is a prequel that might happen
@mightbealvi
@mightbealvi 2 ай бұрын
This could actually be a good ride for Universal Studios
@scottypenguinGaming
@scottypenguinGaming 2 ай бұрын
youre insane metoo😂
@kudvin101
@kudvin101 Ай бұрын
i love how everytime he loops the video time goes back to 24 minutes, it's a nice little detail
@rubykaylaandogie3334
@rubykaylaandogie3334 2 ай бұрын
"GET ME OF THIS RIDE!!" "Please excuse me sir but would you please escort me from this simple train made for ones enjoyment?"
@Wafflefries-wi5rf
@Wafflefries-wi5rf 2 ай бұрын
I have a theory, when he was going back in time years and years past outside the building and it only felt like minutes for him and the reason why police were outside is because his friends must’ve reported it to the police.
@No_James_Here
@No_James_Here 2 ай бұрын
I was 13:59 in and I got an ad for Chuck E. Cheese, coincidence?
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
they know!!!
@Thekrineyesyes
@Thekrineyesyes 2 ай бұрын
I would like to point out how when he goes back to the start, the recording length reduces to the same length when he went on the ride in the beginnin. Also the fredbear head that spat out springtrap could have been a phantom. Otherwise amazing vid❤❤
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
Good eyes man
@PaulIsntMyName
@PaulIsntMyName 2 ай бұрын
I was waiting for you to cover this 💪
@bigpoggers6507
@bigpoggers6507 2 ай бұрын
Theory: The loop is slowly showing bits of what actually happened to George, he was lured by the spirits into the tracks where he got hit. The "loop" is his memory of the event repeating over and over, distorting and twisting as he dies. The time on his camera resetting is from the memory restarting, with every "Springtrap" instance, when pieced together, displaying what actually happened. He gets on, he goes on the ride, he gets stuck at the section with the toys, the spirits use the Springtrap animatronic to lure him into the backroom, he runs out, with the Springtrap animatronic continuing chase until eventually he gets cornered at the start, causing him to run backwards, where he gets absolutely mollywhopped by a cart. The "turn back" from the Puppet being a warning to not enter the toy room as that's where the backroom entrance is.
@elephantality3753
@elephantality3753 2 ай бұрын
True, the Freddy Head could have been what he imagined as he was hit by the Freddy Cart. The turn back, I think is just the Puppet telling him to wake up and live... Maybe.
@aldiascholarofthefirstsin1051
@aldiascholarofthefirstsin1051 Ай бұрын
Why do people like those boring-uncreative-absolute and objectively garbage dream theories? Is it so hard to you to accept the ghost robot bunny has the ability to put the guy into a time loop? Or a pocket dimension?
@elephantality3753
@elephantality3753 Ай бұрын
@@aldiascholarofthefirstsin1051 Doesn't seem likely especially when he leaves and magically is in a cart again. No to pocket dimension.
@aldiascholarofthefirstsin1051
@aldiascholarofthefirstsin1051 Ай бұрын
@@elephantality3753 But yes to time loop, right?
@coleminer8847
@coleminer8847 2 ай бұрын
A small detail The timer in the top left resets to the time it was at during the start of the ride every loop
@zaknorris2653
@zaknorris2653 2 ай бұрын
This is genuinely so cool! The idea that Springtrap is hidden amongst a bunch of animatronics posing as him is so creepy. Especially cause George doesn't even know Williams inside
@datemmie
@datemmie 2 ай бұрын
its funny that the video itself is 23 minutes while fazbear's frights was theorized (idk if its canonical) to take place in 2023
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
I bet he was there for hours.
@datemmie
@datemmie 2 ай бұрын
@@ParanoidHunters to me, it seems like years.
@gavinjames645
@gavinjames645 2 ай бұрын
At this point battington should make their own fnaf fan game 😅.
@xcheeltroncoso2002
@xcheeltroncoso2002 2 ай бұрын
I know, right! Can you imagine how it would look like??
@fried_fries
@fried_fries 2 ай бұрын
He definitely makes really good analog horror videos, but I don’t know if that would really translate well to a game tbh
@xcheeltroncoso2002
@xcheeltroncoso2002 2 ай бұрын
@@fried_fries oh well, a person can dream.. 🙃
@ShadeauxMan
@ShadeauxMan 2 ай бұрын
Universal should seriously do something like this! They already have so lit rides! Like the Transformers one! This would be amazing’
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
Yes but way less scary lol
@ShadeauxMan
@ShadeauxMan 2 ай бұрын
Nah, it’s gotta be terrifying🙏🏻
@Timeless_fnaf
@Timeless_fnaf 2 ай бұрын
i LOVE the vintage 90's synth horror vibe in that beginning commercial so much. If fazbear freights was real it would 100% look like that.
@smoresx
@smoresx 2 ай бұрын
Did you know when the phone guy said code yellow when it first broke down code yellow means a missing rider alert
@AlexLazee
@AlexLazee 2 ай бұрын
I love this VHS so much.
@AwkwardCat23
@AwkwardCat23 2 ай бұрын
Battington my beloved i love his stuff SO MUCH it is my favorite fnaf vhs content, one of my favorite and most quoted videos on the internet is made by him
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
I am glad to see a new one
@nothingrhymeswithorange5294
@nothingrhymeswithorange5294 2 ай бұрын
That thumbnail makes Dawki look like he's in an early PS4 game
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
Dawki? lol
@tkmikki
@tkmikki 2 ай бұрын
they said at the beginning of the video that this was at the washington county fair (which is the actual county Hurricane is in), and I've been there. If this was at the county fair, I would be shocked because, at most, they usually just have like your basic ferris wheel, the one spinning ride, a carousel, and then food and games. not even a spooky ride or tunnel of love. also, props to battington for getting the va for the advertisement at the beginning to say the town name right (its pronounced "her-a-kin")
@bumblefilm
@bumblefilm 2 ай бұрын
this really reminds me of the one stargate sg-1 episode where jack, teal'c, and daniel ended up stuck in the same time loop and you can really genuinely see the insanity start to set in, but with a big lack of self awareness. Out of all the tapes battingtons made this has got to be my favorite!!
@ColorMidEditz
@ColorMidEditz 2 ай бұрын
Maybe with the drinks he had he hallucinated the place not being abandoned and most likely passed out during the malfunction, waking up to the abandoned place, which was most likely an infinite loop setup by Springtrap. I don’t have any theory about the friends and the big fredbear head.
@elephantality3753
@elephantality3753 2 ай бұрын
I do. So if we assume he was hit by a Freddy Cart, I think the Freddy Head was what he imagined as he was hit. The blood? His blood, upon being mangled by the cart. Vanessas screams? Her finding George hit, and he understands half of it and as it distorts... his consciousness fades away. I think SpringTrap killed him at the drop, or he died in the room with the malfunction. Also to note, he was the last ride of the night.
@aldiascholarofthefirstsin1051
@aldiascholarofthefirstsin1051 Ай бұрын
@@elephantality3753 Garbage theory.
@yeahok8259
@yeahok8259 2 ай бұрын
This is why I love Battington. Dude is genuinely creative- and the extra detail of green-screening himself into his animations for better human realism is top tier editing as well.
@PELTIER5
@PELTIER5 2 ай бұрын
Maybe he died on the ride back then and is now stuck in a sort of hell cycle
@ShadeauxMan
@ShadeauxMan 2 ай бұрын
Also- I’m probably not right.. but what if George is the one that died- and he’s reliving his death repeatedly-
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
Yeah it feels like he is the one that is dead. Kinda like he no clipped and is seeing stuff from the past as he is trapped.
@SarahAbramova
@SarahAbramova 2 ай бұрын
It's so cool how people just create so many games/videos based on this one franchise!
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
It is cool. i like it a lot.
@breakingfaffles
@breakingfaffles 2 ай бұрын
this whole video felt like a Fazbear Frights story, it feels like the first time reading one of them again for the first time
@magna-zone1219
@magna-zone1219 2 ай бұрын
My fav part about battington is how he destroys your preconception of what FNAF is and can be
@juliane.mfarias9285
@juliane.mfarias9285 2 ай бұрын
Battintong made the giant Golden Freddy head in the hallway terrifying!!
@larrythestoner2449
@larrythestoner2449 2 ай бұрын
Battington has once again made a masterpiece with his animations! I absolutely love the amount of detail, acting and story he does. I hope he does more in the future.
@gbird.
@gbird. 2 ай бұрын
it would be cool in universal BUT this has clear inspirations from Disneyland haunted mansion/pirates
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
Needs more water.
@BlueToons925
@BlueToons925 2 ай бұрын
The first time I watched this it scared the hell out of me, glad you enjoyed it too!
@TacoQueen33
@TacoQueen33 2 ай бұрын
Battington has always been so good. I adore their FNAF VHS tapes so much!
@btsfan459
@btsfan459 2 ай бұрын
I absolutely LOVE looking at the VHS tapes from FNAF, I love seeing people's creativity, and I've seen some REALLY good ones, they're so cool to look at, and honestly makes me believe that they're real just because of how awesome they are. Love you Dawko, you're an inspiration for me, and really appreciate what you put out to the world 💜💜💜
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
I bet a lot of time goes into the story telling than the models. Have to get each shot right over and over.
@btsfan459
@btsfan459 2 ай бұрын
​@idHuntersExactly! I agree, the fact that people put so much time and effect into these videos is insane, I love how dedicated people are lmao
@BatoonyPants
@BatoonyPants 2 ай бұрын
Every time he goes down the drop, he could’ve blacked out and when he woke up, William afton kept putting him back at the start, and every time he woke up, he thinks the ride keeps looping, draining his sanity. And by the time he finally gets off the ride, it’s a different year, and he finally gets killed.
@_lauragull_4178
@_lauragull_4178 2 ай бұрын
I was waiting until you posted your reaction!! Battington is so talented😭🔥
@ThatOneRandomPerson54
@ThatOneRandomPerson54 5 күн бұрын
This whole tape seems like one of the book stories, like in the Fazbear Fright’s series- Crazy!
@gavinjames645
@gavinjames645 2 ай бұрын
Dawko if you look at the time during the ride it restarts every time he goes down the fall.
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
Yeah it goes back like 20 mins
@ParadoxCore18
@ParadoxCore18 2 ай бұрын
Finally! So happy that you reacted to the new battington video!
@DerKaiserMann
@DerKaiserMann 2 ай бұрын
Battington is great at making these locations feel actually haunted, not just the animatronics. FNaF Plus Break in had it down perfectly is what I thought before I saw this
@runningthemeta5570
@runningthemeta5570 2 ай бұрын
Hell yeah, I saw this and it was so good. I was waiting for either you or Ryan to react to this.
@xaviergarcia5421
@xaviergarcia5421 2 ай бұрын
This was really well made. I cannot wait for more battington or other reactions
@StinkySandism
@StinkySandism 2 ай бұрын
this whole thing gave me goosebumps vibes
@Tarokun874
@Tarokun874 2 ай бұрын
1:50 PERFECT 👌 IMITATION
@facely
@facely 2 ай бұрын
I don't understand how he gets transported back to the ride car when he tries to run away. He doesn't even really comment on that when it happens. I'd be beyond freaking out.
@elephantality3753
@elephantality3753 2 ай бұрын
That to me suggests limbo
@limegreenlive7813
@limegreenlive7813 2 ай бұрын
Since George time goes back to 24 four times I've been able to give you the real time he spent in that ride. In reality George spent 1 hour, 23 minutes and 41 seconds...
@Dani-yo
@Dani-yo 2 ай бұрын
WHY WONT YOU LET ME LEAVE?! RRRRRRRAAAAAAAAGGGGGGHHHHHHHHHH
@ParanoidHunters
@ParanoidHunters 2 ай бұрын
I wonder how long he was there for.
@katiesherman6517
@katiesherman6517 2 ай бұрын
It feels like a Fazbear Fright story! Good stuff!!!!
@fireboytheone
@fireboytheone 2 ай бұрын
honestly, i didn’t even notice that the time on the camera resets on each loop on my first watch through. such a cool detail.
@OdensMovieMagic
@OdensMovieMagic 2 ай бұрын
Wow.
@gigachad6384
@gigachad6384 2 ай бұрын
Yes
@ur_l0c4l_n0nbin4ry_k1d
@ur_l0c4l_n0nbin4ry_k1d 2 ай бұрын
I find it funny, a freind of mine did a FNAF DND thing for Halloween (they were the dm, it was really fun) about Security breach having a halloween special where we get locked in and everything goes wrong. I really like the way Battington made the video, it was really cool and well made!
@puppylover4865
@puppylover4865 2 ай бұрын
I was waiting for Dawko to react to this because he makes it a less terrifying with his reaction and commentary 😅.
@Catnap-creations
@Catnap-creations 2 ай бұрын
I always look forawrd to when dawko posts Love you Dawko
@ChaoticMysteriousEntity
@ChaoticMysteriousEntity 2 ай бұрын
This was an absolutely insane experience and unbelievable phenomenon 🎉 Loved It 🖤 Can’t Wait For What Comes Next!
@JoaoPedro-ol7sl
@JoaoPedro-ol7sl 2 ай бұрын
I think the body mentioned was that person from the other video and he could have died on the first time waiting maybe that's whh Vanessa screams bc she found out he died, or it was springtrap mocking him.
@Rockystan675
@Rockystan675 2 ай бұрын
YEAHHHHH I WAS WAITING FOR DAWKO TO REACT TO THIS VIDEO LETS GOOOO❤❤❤❤
FNAF HORROR REVIEW 3.0
35:53
Dawko
Рет қаралды 655 М.
The HORRIFYING FNAF VHS Case of Edward Morris...
12:24
Dawko
Рет қаралды 164 М.
Зу-зу Күлпәш. Агроном. (5-бөлім)
55:20
ASTANATV Movie
Рет қаралды 600 М.
Which one will take more 😉
00:27
Polar
Рет қаралды 83 МЛН
THE SISTER LOCATION VHS TAPE... - FNAF TUNNEL VISION
18:30
BATTINGTON'S TERRIFYING FNAF VHS TAPES...
15:18
Dawko
Рет қаралды 1 МЛН
THE MOST DISTURBING FNAF GAME I'VE PLAYED...
26:41
Dawko
Рет қаралды 111 М.
FNAF MOVIE MEME REVIEW
21:30
Dawko
Рет қаралды 851 М.
FNAF HELP WANTED 2 MEME REVIEW
20:42
Dawko
Рет қаралды 466 М.
YEP... I FINALLY WATCHED THE WALTEN FILES...
33:04
Dawko
Рет қаралды 1,3 МЛН
Big Construction New Challenge Smiling Critters
0:12
5G Vision
Рет қаралды 11 МЛН
Clash Of Clans X Haaland Troll Face Edit🔥☠️ | #shortsvideo #capcut
1:00
Please Help Steve Take The Water
0:32
ToonToon Daily
Рет қаралды 5 МЛН