Premature baby? || My Pregnancy Experience with Pre-eclampsia? || Australia Tamil VLOG!

#prematurebaby#pre-eclampsia#pregnancyexperience#
I had Pre-eclampsia problem with my first pregnancy. My pregnancy was normal until 5 months, and after that my blood pressure was constantly increasing with swelling in hands, feet and face. My GP was constantly monitering my pressure readings, baby movements, baby’s heartbeat. At the stage of 32 weeks, my GP advised me to go to hospital for further treatment. In the hospital they checked my baby’s heartbeat and on in Emergency Cesarean, Dinesh was born at 32 weeks. He was admitted in Special Care Nursery which treats the premature babies. He stayed for one month. They advised to give express mother’s milk, with nose tube. After monitoring him until he was stable and able to drink milk from bottle without nosetube. As a new mother, I was very depressed to see him in incubator. He had good progress due to good hospital facilities. We are very thankful to those Doctors and Nurses who worked day and night to save my son in Special care nursery. This video is mainly created to make awareness about pre-eclampsia problem and premature baby birth. Please share to moms who recently gave birth to premature baby and it will give some ideas to handle premature babies....Keep subscribed to watch the funny aspects of DINESH and KRISHNA. Thank You for spending your precious time by watching this video.......
For more details about taking care of premature babies at home please visit the link below:
How to take care of premature babies at home from incubator? - • How to take care of Pr...
Facebook - www.facebook.c...
Facebook page - aussieta...
Twitter - / aussie_tamil
Instagram - / aussietamilkids
Pinterest - / aussietamilkids
KZbin - / aussietamilkids
VLOGS
How to take care of premature babies at home from incubator? - • How to take care of Pr...
Inala Fish Market and Asian Market in Brisbane Australia? || Tamil Vlog! - • Inala Fish Market and ...
Tamil Vlog || Kids Special Ulundha vadai and Puratasi Poojai Vlog || Australia Vlogs? - • Tamil Vlog || Kids Spe...
Saraswathi poojai celebration and Busy Bee Dinesh || Tamil VLOG || Australia vlogs? - • Saraswathi poojai cele...
A visit to Samy Indian Groceries Brisbane || Tamil VLOGS ? || From Australia! - • A visit to Samy Indian...
Beautiful Art Exhibition with Stella from Australia! || Tamil vlog ?
- • Beautiful Art Exhibiti...
98th Birthday Party of our Australian Granny? || Tamil VLOG! - • 98th Birthday Party of...
Unboxing Diwali Parcel from India? || Australia Tamil VLOG! - • Unboxing Diwali Parcel...
Please pray for Surjith and Diwali celebrations in my home! || Australia Tamil VLOG! - • Please pray for Surjit...
Kitchen Tour from my home in Australia! || Tamil vlog! - • Kitchen Tour from my h...
Baked Chicken 65 in Sunday Special! || Tamil VLOG! - • Baked Chicken 65 in Su...
Unboxing Samsung S8+ my new gift! - • Unboxing Samsung S8+ m...
How my dad came to Australia in Tourist visa ! || Tourist visa to Australia? - • How my dad came to Aus...
Tamil kavithai!
When I first saw my baby - • என் குழந்தையை நான் பார...
Questions by common people - • பதில் தேடும் சாமானியன்...
Dedicated to all fathers who have daughters - • யாதுமாகிய என் தந்தையே!...
Dedicated to Surjeeth - • சுர்ஜித்துக்கு என் கவி...

[@roseresfire]

My baby born at 32 weeks in 1700kg.she in NICU 15 days. She 5 month 5.5 kg.

[@GOACHITRASEKHARRECIPE]

ஹாய் சிஸ்.... தங்களின் இந்த பதிவு நிறைய பெண்களுக்கு பயனுள்ள தாக இருக்கும்.உண்மையிலேயே தங்களின் மனதைரியத்தை பாராட்டுகிறேன் சிஸ்.அம்மாவின் உடல் நலன் கருதி சென்னை யில் இருக்கிறேன்.அதனால் தாமதமாகி விட்டது.சாரி பா.அருமையான பகிர்வுக்கு பாராட்டுக்கள் சகோதரி 👏👏👏 தினேஷ் கிருஷ்ணா இருவருக்கும் எங்களுடைய ஆசீர்வாதங்கள் சொல்லுங்கள் சகோதரி 🙏

[@AUSSIEtamilkids]

Thank you dear GOA CHITRA SEKHAR RECIPE Sister 💐💐💐 we need your blessings and I can understand your situation, and I will pray to God for your mother, take care dear 💐💐💐

[@APPLEBOXSABARI]

No words to say. It is really a tough condition. Could understand how much hardships you faced during pregnancy. I must have created too much of stress in you. All these pains are for this healthy thuru thuru kid :) This message will be an encouragement to many new mothers. Positive Thoughts are needed during pregnancy !! Also having a baby in neonatal care is unimaginable. It is like having our heart out of us. You have been strong to go through this reality. Kudos and my wishes to you all !!

[@AUSSIEtamilkids]

You are absolutely right dear Sabari Sister, thank you so much 💐💐💐

[@tipsmakesimple4368]

Romba useful information for pregnant women.pregnant ta errukum pothu payamathan errukum .romba struggle pannierrukuringa.

[@AUSSIEtamilkids]

thank u dear...

[@momslittlekitchenandcrafts]

Good morning sister,rompa kastta patturukinka,ippo kulanthaiya parkum pothu santhosam 👌👌👌💐

[@GechusWorld]

Thanks for sharing your pregnancy story. Glad everything came out good at the end. God bless. Have a blessed day.🤗👍😍🙏

[@NaveenKousiSai]

My girl baby born at 32 weeks in 1.3 kg. Now she completed 15 months 7.5 kg . Same problem pre eclampsia but fits varala sis enaku swelling mattum irundhadhu ennoda bp level 180/100 irundhuchi. Baby born ana odaney 100/60;

[@gayuangelrock]

Mother milk ah koduthinga

[@NaveenKousiSai]

@@gayuangelrock ama sister mother milk than.. but first 6 months 2 hours ku once kuduthen.. oru side 1/2 hour and another side 1/2 hour feed panuven and last ah two sides um vara hind milk ah pump panni lactodex 1 g satches power 30 ml milk la add panni paladai la kodupen sis.. oru 6 months complete agura vara idha follow pannen monthly once 1 kg weight poduva.. now she completed 17 months.. weight 9.3 kg Iruka...

[@gayuangelrock]

Sis enaku mother milk ila born day la irunthu formula milk only kodukuren Nov 4 tha poranthan one mnt aachu born wt 2.300 ithu kudicha wt poduma sis

[@NaveenKousiSai]

@@gayuangelrock pre nan pro formula milk use pannunga sis.. neenga medical la ketta kidaikkum and formula milk 30 ml eduthu lactodex pack mix panni kodunga one day ku 3 packs lactodex powder tharanim sis

[@mylittleangel9637]

32 weeks ellam problem illa 28 weeks baby safe than

[@mohansundaram2]

We are lucky have dinesh she is best mom I take care in pregnancy but it’s not easy situation it went emergency in mid night after delivery dinesh went danger sign I am alone I can not look both side my wife in operation theatre left her i taken dinesh to emergency special care nursery there 4 doctors come help him start put injection given medication immediately he got life back we need say thanks to doctors & god in my life never forget but my wife prayed see church sign in hospital bed god help her we lucky to get dinesh I love my son too much 👌

[@GOACHITRASEKHARRECIPE]

ஹாய் சிஸ் வணக்கம் 🙏🌹... எப்படி இருக்கீங்க.... ரொம்ப நாளாக தங்களின் பதிவு வரவில்லை..... தினேஷ் கிருஷ்ணா எப்படி இருக்காங்க.... தங்களுக்கும் குடும்பத்தினர் அனைவருக்கும் இனிய பொங்கல் திருநாள் நல்வாழ்த்துகள் சகோதரி 🙏🌹

[@AUSSIEtamilkids]

We are in difficult situation in our lives, due to forest fire our home is damaged. We are now getting recovery and when the situation gets better, I will start posting videos, but it will take time. Advance pongal wishes to you dear. All are fine.

[@indhujaandavar4592]

Atengappa en baby mattum ippadi poranthutanganu feel pannitu irunthen..but Inga comment la evvalavu per share panirukanga

[@subhaskitchen4387]

என்ன சொல்வது, எப்படி சொல்வது. எல்லா பெண்களுக்கும் பிரசவம் என்பதே மறுபிறவியாகும். அதிலும் நீ குழந்தை பிறப்பின் போது தனியாக நின்று தந்தை, கணவரின் துணையுடன் அளப்பரிய சாதனைகளை செய்து சமாளித்து உள்ளாய். உன் தாய் உனக்கு அந்த அளவுக்கு தைரியமாக வளத்திறுக்கிரார். இதேபோல் இன்னும் அளவில்லா சாதனைகள் படைக்க என்னுடைய வாழ்த்துக்கள் மகளே.... 😊😊👍👍

[@AUSSIEtamilkids]

thank u amma...

[@Perumpidugupradeep]

Hi guys I’m Pradeep my wife pregnant now with uterus fibroids. Neraya doctor negative ah solranga successful delivery Sollunga pls yarachu ipdi face panirukingala

[@sts5779]

First 3 month injection poduvanga no problem

[@australiatamilexpress9355]

Every mom has these kind of story pari sis! You are really great ! You have came across so much struggles and pain! I still appreciate your guts coz you didnt even afraid about your 2nd delivery ! Mine was also worse but you said Australia is the best for delivering the baby but in my case its different! Enna kastamnalum now we have our cute pies in our hands! Thats enough! Every woman is a real warrior! 💪🏽👍🏻 great sharing sis! God bless 😊

[@AUSSIEtamilkids]

Dear Australia Tamil Express Gracy Sister, thank u so much for sharing your beautiful comments 💐💐💐 Brave mom of two kids and you are absolutely beautiful caring mom, I like you so much dear sister 💐💐💐

[@australiatamilexpress9355]

Aussie Tamil Kids & Vlogs you are so kind😍

[@srimathic6450]

Mam enga akka ku same ungala mari problem tha mam enagalukulam romba feeling ah iruku 😭😭Murugana nanga ellarum venditu irukom🙏 baby weight 850grms

[@SamuelSarah-z6k]

Ippo Baby Nalama Sis

[@linsinfotainment6925]

thanks for ur pregnancy story sis.. u come across with pain

[@kuttalatamiljeyalakshmi9942]

Very useful information for pregnant women and pregnant aaah irukkum pothu kandippa payam thaan aathigama irukkum neenga rompa kastapatirukkinga sister kulanthai ya parkkum pothu evlo santosama irukkum solrathukku varthaiya illai sister avlo kasatam take care sister all ladies Kum very useful and helpful video sister thanks for sharing unga speech il theriuthu anupavathithu pesiyathu sister......

[@madras2parisfrancetamilcha665]

Very detailed share sis...will be useful for all future moms...Glad that u have 2 healthy boys now...God bless u and ur family always 🙏

[@GreenEasylifeUK]

Hello friends. Thank you for sharing this useful video..😍😍

[@Linux-xz7kv]

My current situation is same story. 22 days OLD in NICU. Weight 830grams. Delivered at 28weeks. Your words help us to stay strong.. Thank you so much

[@rubhasaju317]

Now baby ok sis

[@SaikuttysSaranya]

Ipo ethana month baby ku sis unkalku ipo Wight ena

[@Sandakari143]

Baby epdi irukanga pls sollunga

[@ramshibacchi5608]

Etre dys nicu l vechirk sis baby ye ...etre cost ayirch

[@Linux-xz7kv]

@@Sandakari143 we lost

[@MadhuMadhu-bn5lz]

Great sharing sis.same story as mine but my baby girl don't survived.now I have a healthy baby girl I too don't pre eclapsia for my second baby.

[@AUSSIEtamilkids]

God bless you dear sister and baby! sorry to hear!

[@kittylove8520]

Hi... Yepdi unglku second pregnancy la preeclampsia avoid panninga...pls Help..

[@MadhuMadhu-bn5lz]

@@kittylove8520 bp tablets given prior itself. I was more in rest for entire pregnancy period sis. Have a control in thyroid levels too

[@kittylove8520]

@@MadhuMadhu-bn5lz Unga second baby full term aa pirandhangla... BP yedhum varla la... First baby apo yethana weeks la unga baby irandhanga

[@MadhuMadhu-bn5lz]

@@kittylove8520 first baby 8 months pa second baby 38 weeks. Pregancy Apo enaku Bp varum after delivery normal agum

[@ramyasashti3758]

Sister primature baby food chart vedio podunga pls enakku primature baby tha enna food kudukkanumnu thariyala

[@Ram-to6ye]

neenga sonna problem en thangachi kku irunthuchu ,face lam swell achu at 6 months la bp reduce tablet koduthanha but baby demise achu so intha awareness video kandipa venum engalukulam therila

[@ravichander2342]

Thanks mam now as same problem in here unnga video va padhadhu manasuku neemathiya erukum

[@HomemakersJournal]

Thanks for sharing your pregnancy story..You have overcome a tough situation.. Will be very useful for pregnant women.

[@shaipavi2422]

Sister please reply ugalku urin protein ircha during preeclampsia? Please reply I so stressed

[@SheCooks]

You are very strong sis.. God bless you

[@AUSSIEtamilkids]

thank u dear sis...

[@denynurhasanah]

Nice.... 👍❤

[@hariniharshan2716]

Me too had same experience.... delivered a baby girl in 8months. Weight 1.485..... Suffered a lot. ..now she a active age 4yrs

[@sowmisowmiya3686]

Akka same ean ponnu koda nethu 8 month la poranthuta ka icu la oxigen kudukuranga ethum positive ah solla matranga pls waiting for ur msg

[@hariniharshan2716]

@@sowmisowmiya3686 sis..don't worry...papa weight enna...avalukku 100 medicines kuduthalum best medicine unga care m thairiyam m than

[@hariniharshan2716]

@@sowmisowmiya3686 if u don't have any objection pls tell me ur num

[@hariniharshan2716]

Papa ku 8months vara romba kasta Patten....na matum than thookuven. Weight lam gram gram a than increase agum.dont get fear...normal Babies pola growth expect pannathinga sis... Pre term babies ku brain sema active ah irukkum..again solren unga thairiyam matum than important...Vera ethum vendam..

[@hariniharshan2716]

Oru orutharum oru advice pannuvanga...ethaiym kathula vangathinga... doctor sonnathu seinga..vitamin d,e lam follow pannunga...breast milk kudunga...ethum doubt na msg pannunga sis...

[@Chennai2ChicagoTamilVlogs]

You are so strong sister, ‘kids tamil’ sis said about this video so came and watched

[@AUSSIEtamilkids]

thank u dear sister!

[@divyasworld-tamilchannel9384]

Romba kashta pattuirukkeenga sis, useful information sis, great success dear , two sooper singa kutties, God is great dear 👍👏☺☺❤

[@AUSSIEtamilkids]

thank u dear sis

[@vasanthir438]

அருமையான பதிவு மா உங்களுக்கு நன்றி மா என் மகளுக்கு 32 வாரம் ஆகிறது அதனால்தான் இந்த வீடியோ அவர்னஸ் இருக்கு மா

[@kidzplay5241]

Thank you so much for sharing your experience with us

[@anujasharmili]

hi sis.my baby also born 34 weeks.i have faced same problem.now my baby has 3 month old.he s taking milk by bottle only.but some times he s troubling cough while milk drinking.nenga ipdi face panirukengala.?like purai eruthu solvomla antha mathiri seiran.nose valiyavum milk varuthu some times.ithuku ena seiyanum.?normal ayiduma?

[@AUSSIEtamilkids]

Dear sister, while feeding, keep your forearm under his head and neck, your hand holding the baby, baby in your lap, so that he will be in inclined position. It will reduce the cough while drinking milk. Also check, the nozzle of the bottle, try to use small hole in the milk bottle. If milk flows more than the baby drinks, it will also make the coughs. Try these tips sister. After drinking also keep the baby like sitting or inclined for sometime, until burp, gently pat his back, then this problem will be solved. All the best dear sister and congratulations. God bless you and the baby!

[@RamitandMom]

Definitely it will helpful someone.....Great experience

[@vinothakesav6802]

Hi sister enku 33 week la baby porandhuruku innaiku 4 days aguthu ana muchi veda kastama iruku nu ICU la vechi irukaga sister. 4 days kalichi today baby ku light ta manjakamalai iruku nu solraga. Epo evalo nall oxygen vechi irrupaga epo recover avaga sister konjam solluga sister usefulla irukum payama iruku. Ana baby weight 2.500 iruku.

[@womensspecial9100]

Ipo epidi irukangahh

[@saranyathiraviam3202]

Sis enakum preclampsia 7 monthla start achu ana enaku atha pathi awareness ila athanala 36 weekls bp high achu. C- section panitanga baby 2.200 iruthan ithunala baby milestone crt reach avana soluinga sis pls

[@ShilpasCorner]

*Nice share dear....*

[@venkis2372]

Sister same problem for my sister ..she is now 31 weeks baby is 750 gms..we are afraid alot ...we are showing in apollo chennai.

[@gowsikitchen9705]

How is your sister and her baby sis

[@venkis2372]

@@gowsikitchen9705 hi sis she lost her baby after birth

[@gowsikitchen9705]

@@venkis2372 oh sad I too lost my baby at 27 weeks her weight only 820 grams

[@venkis2372]

@@gowsikitchen9705 oh be strong

[@venkis2372]

Everything will be alright

[@sameemashahul1393]

Hi sis.... Unga delivery pola thaa enakum nanaum en baby poranthu romba kasta pattan 34 week la baby weight 3. 600 aairuchu nu oppression panna sollittanga muchu vidala kannu thirakkala romba alugala sound low ah aluthan apram NICE la vachu treatment pannaga baby ku 2 week 17 days achu hospital thaa irunthom ipa 2 month completed feed pannittu thaa irukan but enaku milk supply commiya iruku weight 4 kg thaa iruka dr 5 kg irukanum solluranga some time feed illana nan pro kudukkura weight yera mattuthu... Premature baby ku food epa la irunthu start panninga.... Ipa nalla activa irukan Weight yerala

[@AUSSIEtamilkids]

Dear sister, congratulation. God bless you and the baby! I had posted another video about premature baby. It will be helpful to you. Thank you...

[@sameemashahul1393]

Thanku sis kandippa video podunga....

[@preetha1988]

Hi mam, my baby girl born at week 30 and she was 800 grams.. Still in NiCu.. Pls post a video on how to take care of premature kids at home

[@AUSSIEtamilkids]

Sure dear sister, I will post a video of how to take care of premature babies at home. God bless you and your baby!

[@akshaselvin5883]

Don't worry sister my baby premature baby .born time only 1.600 now 7 kg super aha iruka. Nenga nalla sapidunga nalla breastfeeding pannunga......baby aha rompa take care pannikongo.....

[@ranganayaki4595]

Hi preetha sister ennoda son 880 grams tha eruntha anakum premature baby tha naga hospital la erunthu one month achu vittukku vanthu unga number kuduga sis I am Ranganayaki from Coimbatore

[@lalithajayaraman5043]

@@ranganayaki4595 unga son ipo epdi irukan

[@ranganayaki4595]

@@lalithajayaraman5043 fine ma

[@DurgadeviDevi-ee3se]

Mam enaku 24 weekla kuraipirasavam aakituchu mam. Ithunala atutha baby pirablam varuma mam , atutha baby ku thaiyal potta baby nalla padiya pirakuma mam.

[@houseplanssrilanka7673]

Yen apdi achu

[@DurgadeviDevi-ee3se]

Infection akituchunu sonnanga mam vera ethuvum sollave illa mam ippo na thirupium pregnant a irrukure mam

[@houseplanssrilanka7673]

Congratulations sis ❤

[@DurgadeviDevi-ee3se]

Thank you sister aana ennaku romba payama irruku sis doctor ippo ellam nalla irruku nu sonnanga sis aana stitch 3rd month scan la paarthuttu podanum sonnanga sis

[@Ouristamcooking]

I gave birth two children...Frist and second pregnancy I suffered due to pre eclampsia....2nd pregnancy was 30 weeks

[@Theoden0621]

Hi What about the weight gain of the baby in 6...7..8th months?

[@gayathribaskaran1421]

How r u now? Is ur bp get back to normal?

[@Ouristamcooking]

@@gayathribaskaran1421 after delivery it went... Nrml agirchu within 7 days...

[@Ouristamcooking]

@@Theoden0621 I was discharged after 2 mnths of my delivery at that time my first boy was 1.100gram only he was gradually increased his weight 600 to 700 grams only monthly monthly...not all babies like that some baby get faster weight gain.. No problem...

[@keerthanarajendran1202]

Enaku premature baby tha 30 weeks la born with 1.5kg enaku breast milk segregation romba kammiya iruku formula tha kudukare now 2.2kg irukan 2 month old

[@gayuangelrock]

Sis same nanum formula tha kodukren wt poduma

[@keerthanarajendran1202]

Kandipa podum sis

[@APPLEBOXSABARI]

Sister, I have mailed you. Pls check 👍😃

[@AUSSIEtamilkids]

Dear Sabari Sister, how are you? I checked the email, I can't find your email.

[@dineshj1998]

Useful Information

[@divyapraveen8663]

Same problem sis .but my baby is no more

[@mohammedziyad6344]

Same thing.. For me also.... Twice

[@vijayalakshmikviji3045]

Hai sister enagu 36 weekla bp athigama irginu csection panaga 36weekla porantha premature babya soluga plzz

[@pavissweethome]

36 weeks la iruthu 40 weeks vara normal tha premature illa

[@mathicreation798]

Hi sis Ennku Cervical open agiiruku sollitaga romba Payama iruku Eppo venulam delivery agalam Aptinu solraga. Weight thukakotathunu sollitaga kuninthu lam vela Pakka kotathunu Solliruga .Cold. Erumal athikama iruku romba Payamavum iruku epponaallum delivery agalam sollitaga .ennku romba kastama Payamavum iruku enna panrathune Theriyala romba Payama iruku 😂😂😂😂

[@sreevidyaa6540]

Akka enakum premature baby than pirandhu one month aguthu

[@malligai3543]

Same story sis i had a lot problems..

[@kalyanasundharamusharani1024]

My wife praganant sister. Thank your information.

[@meenabaimani1557]

Enakum 1st pregnancy la bp iruthuchi same problem sis.. IPO 2nd pregnantah iruken 2nd time yum varuma

[@baskar-j3m]

2nd pregnancy OK VA mam

[@BhavaniSaiChannel]

😢😢😢😢😢😢Feeling very sad ma....

[@suganyaa9347]

Unga baby yentha month turn over pannunanga... Milestone video podunga sis...

[@smartson6059]

Mam en payan premature baby tha three year agthu enum pesa start panla unga videos pathtula avna pathi ertha payam kami achu thks

[@anushaanusha4684]

Yanakum same problem than sis 33 week rompa kasta patern

[@Ushasharmakitchen]

Good mornig my dear frnd very nice video 🙏🙏🙏👍👍👍

[@prithikasadhasivam3060]

Hi sis... My first pregnancy was similar to you..upto 5months I was normal, but after that swelling in legs, hand, face.. Bp got increased,, nd I was undergone with emergency C-section in 31weeks.. My baby born with 1.3kgs..she was n NICU for 21days.. Now she s two years old.. Very hyperactive.. Sis pls share ur second pregnancy ,what r d precautions u took for second pregnancy... Pls share

[@AUSSIEtamilkids]

Dear sister, my son is also very active. Don't worry and pre-eclampsia will not come in other pregnancy. I din't had that problem in my second pregnancy. I will share. God bless you and baby!

[@prithikasadhasivam3060]

@@AUSSIEtamilkids okay sis Thnq very much fa ur reply

[@MommyNBaby]

prithika sadhasivam pls subscribe to my channel

[@komathimariapan8890]

Hi sister. Thank you for sharing your pre eclampsia journey. Please share what precautions you took that you din't have preeclampsia symptoms in your second pregnancy.

[@Ouristamcooking]

@@komathimariapan8890 my delivery also like preeclampsia only ..my first son born 900, grams 2nd daughter 800 grams...both are on NICU nearly 2 months....my first son only suffered lot his lungs got infection lot ...so he could not breathe properly

[@maddymayilvanan]

Yellam avan seyal akka Neram kidaicha yennudaiya keezhadi pathi pesirupen parunga

[@AUSSIEtamilkids]

Sureah kethuparkiraen brother 💐💐💐

[@maddymayilvanan]

@@AUSSIEtamilkids nandri akka apoapo தொடர்ந்து ஆதரவு கொடுங்கள், நான் உங்களோடு பயணிக்கிறேன்

[@howtomakebygayatri8096]

Good video friend.... Like 👍👍👍🌹🌹🌹

[@vidhyap3309]

Akka unga baby entha month face pathu sirucha plz reply

[@thegarnishr5080]

Great will power sis !! 👍🏻

[@vasanthinandhini2151]

Unga baby oda dvlpmnt epo strt aachu.. enoda baby ku adhu usefula erukum

[@nishanthib903]

Neenga evlo month paladi feeding kuduthinga sis my baby also premature pls reply sis

[@Ouristamcooking]

Same problem I face what u have suffer...I gave birth to my son during 28 weeks of my pregnancy

[@2k_couple_mr_mrs]

Sis 28week LA baby porantha ethum problem illala..enaku 25 week aguthu epa vena delivery agura mari iruku solirukanga normal delivery agirumla..sis plz reply for me

[@rubhasaju317]

@@2k_couple_mr_mrs baby born ah sister

[@ramshibacchi5608]

Baby evlo weight iricch sia

[@Ouristamcooking]

@@2k_couple_mr_mrs niču facility ula hosp la delivery ana no prob sis... Eb paiyanuku 5 years agthu...

[@Ouristamcooking]

@@ramshibacchi5608 900grams ma... He is now 5 years old...

[@dharshinidharshinidharshi5258]

Ewlo naal NICU la irundhaga ewlo weight vanthathum ungkakitta thanthaga plz rly

[@susanamiraclin4981]

My pregnancy story is same as yours and yesterday we discharged her . please share how to handle her after coming home please guide me

[@AUSSIEtamilkids]

Dear sister, I had posted another video, how to take care of premature babies at home from incubator, in the same youtube channel and you can find the link in the description below. God bless you and the baby.

[@girijadilipkumar3791]

My son also premature baby am also facing this switchvation

[@varshikaskitchenlifestyletamil]

Kadavul nambikai jastiya irundha kandipa kapathuvar...unga family Yoda vendal nalladavey irundhuchi....neenga evlo kashta patrupinga...en Mami ku kuda edho problem Pola first and second baby kuda problem avangaluku 5 month laye papa velila vandhuducham stritch potrukanga 9 month la pirichitanga..aparam papa porandhuchi..Enna 1 day fulla Amma Kita katla enaku Kodi suthichi...nanum serious condition la porandhen...adhukey Amma kasta patanga but neenga papa porandhu 1 month pakala romba kashtam....don't feel ipo Krishna kutty romba chutty...pinadi Krishna orey amakalam..Nan avanaye note panitu iruken 😀😀😀😀

[@KidsandKitchen7]

One day nicu ku evlo vanguvanga sis?

[@SamuelSarah-z6k]

Yethukku Commend Pannuringa Oru reply illa. Doubts no Clear

[@suruliminnilayam4286]

Useful tips

[@senthilkumar-ne9fk]

Hi, premature baby will have any physical and mental issues ?

[@healthytips261]

Sis enaku 7 month next month 1 dhadi complete agutu enaku ammakattu vanthuruku ithunala baby ku ethum prblm varathula

[@Bhuvaneshwari555]

Mam, enaku 6 month pregenency complete aaga podhu en papa adivayiruku keela eranguna Mari feel achu na doctor Kita consult pannapo , scan panni keela dha erangiruku nu sonnanga .. and garpa Pai internal ah open aagudhu nu stritch pannirukanga , bed rest eduka sollirukanga , na ippo bee rest la dha iruka stritch panni 4 days aagudhu irundhalum enaku papa adivayiruku keela irukura Mari dha thonudhu sila samayam veliya vandhurumo nu kuda bayama irukum .. but pain , bleeding edhuvum illa , Ennoda doubt baby keela vandhutu pochu na problem iruka illaya ? Enaku puriyala konjam solringala

[@kalaivani1014]

Ipo epd irukeenga? Nanum stiches potruken 6th month.

[@Bhuvaneshwari555]

@@kalaivani1014 thank you for reply mam, na Nalla iruka , 9 month la stritches remove pannita , ippo normal delivery airuku mam ippo papa porandha Andha Eve fix vandhruchu hospital la sethu papa Ku teatment pathutu irukom mam , treatment poitruku

[@sharathwizam6094]

Ungaluku cervix open achi sis

[@rubhasaju317]

@@Bhuvaneshwari555 during pregnancy tablets injection lam pottagala sister

[@Bhuvaneshwari555]

@@rubhasaju317 no injections ma , enaku podala only blood test Ku blood kuduthen .. and 3 month la government la oru injection potanga baby kaga adhu enna nu clear ah therila marandhuta ma , adhu normal ah ellarukum poduvangalam

[@kaleeswaran4130]

Head Epo nenuchu Susy. Because my baby also premature 6month boy baby. Head nikla

[@LekshmiArunachalam]

Sis unga babiku ipo head nikkutha because enakum Pre matured baby than inum head nikkala athan keakiren

[@saani-yadi]

Useful information suster5

[@nagarajan2469]

குழந்தை எடை எவ்வளவு

[@manimayil7413]

எத்தனை வாரத்தில் பிறந்தான்

[@Shadow_God03]

Hii ena Eclamptia ahh problem Irunthuchi first baby ku delivery timela bb athigama aagi fix vanthuruchi en paiyan 37 weekla Poranthan normal delivery tha but weight tha kammi 1780

[@malamala6693]

Evalo days hospital la irunthiga sis

[@gayathribaskaran1421]

After delivery epo bp normal achu sis

[@meenaloshanit1136]

Hi sis same to my pregnancy story pls share some weight gaining food and recipes for premature baby

[@aarthijoy8715]

Hai Mam...3 rd month scan la pre enclampsia Increased Risk nu Sollirukanga....Ippo enna Pannanum mam nan? Reply me please....🙏🙏

[@KeerthiKeerthi-im7tv]

Enakum athe than sonanga...pls sollunga enna aachu

[@gayathribaskaran1421]

Ipo epdi irukinga sister

[@gayathribaskaran1421]

@@KeerthiKeerthi-im7tvenakum preeclamsia irundhadhu but safe delivery dhaan

[@gayathribaskaran1421]

@@KeerthiKeerthi-im7tvbayapidama irunga sis

[@gayathribaskaran1421]

Bp normal aacha sis

[@umaparthi4810]

Normal delivery ukkallukku achieve sister

[@PriyankaManikandan-jt8fy]

Akka ennoda baby 28 weekla porathutta..36 days nicu la vaichurothom ... 38 days la eye check up pannom Rop irukku.. Sikram madurai aravidh kk poga sonnanga.. Udane eye la injection pottanga... Akka rop paththi theriyuma ka.. Sikram sariyatuma ka

[@kowsalyaabirami1176]

Ipa unga baby weight enna sis..en babum 28 weeks porandhutanga..now 5 days ah nicu la irukanga...pls ipa papa epadi irukanga sollunga weight evolo irukanga

[@rubhasaju317]

@@kowsalyaabirami1176 now baby fine ah sister

[@kowsalyaabirami1176]

@@rubhasaju317 dead

[@rubhasaju317]

@@kowsalyaabirami1176 weight evlo sis

[@kowsalyaabirami1176]

@@rubhasaju317 2750

[@momgift1295]

Tq akka

[@linsfashions8812]

romba kastapadurukinga sis. nice sharing sis. pregnant ah irukum pothu evalavu kastama iruthurukum sis

[@manishalu1410]

Mam enakkum same problem but 10% kapatha mudiyum nu soldranga twin oru girl papa oru boy papa ungalukku papa normala aaga evolonal atchi

[@rubhasaju317]

Now ok sis

[@srilakshmi3008]

Super video dear

[@suganthivssuganthivs6870]

Akka.evlo.naal.anathum.papava.kulikka.vechunga.evlo.wait.irunthathu.sollunga.evlo.neram.kulikka.vechunga.sollunga.plese.akka.en.papa.8.monthla.poranthathu

[@user-ck3jv6xg7h]

Aarogiyama irukangala sis

[@yasodhadevi8652]

🙏🙏🙏 sister

[@sasic8248]

Mam fst baby premature thn next baby kum ipdi aga chance iruka

[@sowmisowmiya3686]

Same dout pls reply pannunga sis

[@Georgeajitha]

I have 9 month premature baby kindly share what u have handled till 2years pls

[@AUSSIEtamilkids]

Dear sister, I had already posted another video about taking care of premature babies at home, it will be useful to you. God bless you and the baby!

[@kirankiru1506]

Pregnant every 8

[@nandhinisidhu3838]

Baby eppo saute pannanga sis

[@kasram804]

Neenga kadavul maari Ena kapathitinga payanthute irunthe yea baby gum development delay aaguthu reason premature baby thank you mam

[@ruhimahir304]

Baby Premature ah poraka reason enna sis.. Enaku walking pona stmch rmpa tight ah aaguthu then waking continue panna stmch la pain varum.. Dctr kitta sonna baby premature aaguratha iruntha intha mathiri irukumnu solranga.. Enaku ithu 7th mnth

[@mah2597]

Baby born sis

[@premalatha7939]

Mam engaluku 5 yrs ku apram epothan consive airukan, 5 month us scan anomoly scan la baby ku ellamey normal but hand, leg bones mattum 3 weeks ku measurement low eruku solranga, paiama eruku, athuku amniocentesis test eduka solirukanga entha details thyriuma yarukathu plz share

[@houseplanssrilanka7673]

Baby porandhacha?

[@premalatha7939]

@@houseplanssrilanka7673 mm boy baby

[@houseplanssrilanka7673]

Normal deleverya?

[@houseplanssrilanka7673]

Eppo delevery aachu 39 weeklaya?

[@hokihorastv8066]

Great sharing