Rheumatoid Arthritis का जड़ से सफल इलाज | Best Treatment of Rheumatoid Arthritis

[@AdhiyogaSystem]

Sir, I appreciate the completeness in your videos. Thanks and God bless you.

[@nasirgajiyawala2927]

Àà00p

[@jayalaxmichatla655]

Thanks alot for detailed information sir🙏

[@nanjunanda5638]

Ye medicines bahut effective h.first day se relief milta h .Thank you doctor.God bless you

[@jacintafrancis1734]

Thank you doctor very much. God bless you.

[@aakashirkule7000]

खूपच छान माहिती सर धन्यवाद

[@shalinibhowmick]

I'm suffering from rheumatoid arthritis...I'm 22 now....I'm very very shocked when I saw my report 😭😖..I'm totally agree with you sir

[@subbukhansubbukhan544]

Dnt worry inshaAllah ap bht jald achi ho jaogi bas pstv sochoo or healty khaoo plzzz

[@shahidwani6733]

I think it is only a myth not fda approved

[@richasaxena7139]

Thank u dr sahab. Very good explanation for ra n medicine too.

[@YogendraKumar-yl9qg]

Lots of thanks for charity like service ..

[@MuhammadShafiq-dy7bt]

Very nice and useful information. Bundle of thanks for uploading such kind of knowledgeable video.

[@m.zayyanimran475]

Me pakistan me rehti ho me ye medicine kesay lo

[@shivanichhabra1166]

mere friend ke grand mother ko bhout time s arthritis ke problem thi fir maney onko ek din planet aurvdha k bary m bateya fir ono nay planet aurvdha k punarnava capsules leney start kiey ab onki problem bilkul thek hai thanks to planet aurvdha

[@kavitaatram9278]

Thank you so much Dr. It's very helpful to me

[@nikhiltank8162]

Thank you sir, Aapne KHUB achhi tarah samjaya HAI. Mai homoeopathy ke bare me janta HU. Ek chhote video me KHUB a achhi tarah samjaya HAI AUR logo ko fayda hoga. Thank you

[@sattakinggalidesawer2959]

kzbin.info/www/bejne/m5jTo2iqgJ1lnsU गठिया का Free इलाज

[@jameskuttyjoseph656]

Best explained quickly and so nicely. In my experience,LEDUM also works good..

[@munnaaash2639]

Sir, aap ne muskurate huve samjhane ki shuruat ki vahi se dil khus Ho gaya. Bahot hi achchha samjhaya sir. Mujh se pen se likha nahi Jata... Anguthe me dard hota hai aur sath sath me ungliya bhi jakad jati hai.

[@lalitkumar-lg2cl]

Sir,Good information& I request you to upload a video on knee gap in cartridge or cracking sound in knee buring motion.I hope that you will consider my request.

[@dloberoi3769]

Very useful information for RA patients

[@SaddamHussain-zk6ho]

Excellent lecture sir I follow u Keep it up 💖💖💖

[@chandrakantparmar6737]

बहुत बढ़िया से विस्तार पूर्वक समझाया मान्यवर

[@virpalsingh8017]

Thanks. .. Soooo nicely defined. ...Doctor is next to God. ..now i start your medicine , in the name of God. .

[@kusumkotak7273]

virpal singh

[@hindisongswithpoonambhatia6838]

virpal singh how are you responding to the Medecines?

[@raajutailor3360]

., ,

[@naritapuina1932]

Not everyone speaks ur language but nice to understand u i have rheumatoid arthritis n I'm always looking up online fr nz Auckland

[@arpitshivhare217]

Is it fixed now

[@jindagilive1285]

Thanx a lot Dr sir, for very detailed & philanthropy video for needy persons..

[@sandeepshah9489]

You explain very well

[@sanjaypadshala5901]

Best RA Information

[@roshirun]

Since homeopathy is a natural treatment , it would be good to discuss the root causes....Else, there's no difference between allopathy and homeopathy.

[@KashmirSingh-mm4lh]

Best information Thanks

[@YashHomeopathicCentreJodhpur]

Thanks

[@dimplegohel5392]

Hello sir, Aapke videos bahut hi achhe lagte hai, thank you for sharing

[@maya.vermamayabp2204]

MeraERS result 45 h mujhe sare symtoms h medicine kanha se mangau thank u

[@mayakharor767]

Best information sir......thanku

[@krishna44440]

Sir Pranam My wife's age is 32 C-Reactive Protein (CRP) 10.1 Rheumatoid Factor (RA) - Quantitative - Serum 66 Anti CCP- 4.7 Please sir explain

[@nituram3615]

Thank you Dr. For good information.

[@nargissachdeva9627]

Good information thank you ,

[@sitarampanigrahi7377]

Sir namaskar... Aap ki ye video dekh Kar mujhe bahut mentally relief Mila. Or is bimari see piditi hnu.......

[@sitarampanigrahi7377]

Mujhe kuch upaya bataye

[@takeshwarisahu9227]

Good explanation thank you so much sir 🙏 I am Rheumatoid arthritis patient

[@inderjeetkaur7484]

I am Rheumatoid arthritis patient I live in mohali Mai kon c medicine lu? Aap ka clinic kanha hai

[@shubhamsawant2908]

@@inderjeetkaur7484 joint pain relief ke liye whatsapp me 8459218390

[@sewarammasram4317]

Very nice explain .thank you so much

[@rohitbajaj2410]

Nicely explained Dr Rawat Sir. My aunt's bone pain was so severe that she was unable to sleep during night hours and can't even walk or stand. But thanks to Planet Ayurveda's RA care pack. Within just 2 months she can stand and walk using a stick alone.

[@atmoshperictemperatures3631]

What planet ayurveda medication your aunt used?

[@SonuSingh-zh2pe]

Plz tell

[@rupikaur2879]

Very good explanation fast quick n accurate

[@tushitvlogs7706]

Dr.namaste ! I am from Nepal and my husband is suffering from Adult onset still desease and his WBC counts remains high with RA factor 24U/L along with anemic . Also since last 6 months he is suffering from fever too . Please doctor help me how to diagnose and get rid of these as soon as possible.also lack of appetite and bad weight loss.poor body ,joints and muscles pain . morning stiffness .please doctor reply me, it would be very kind of you.

[@mokshit1147]

Go to any Rheumatologist he can cure his fever and pain I was also suffering with same condition but i am only 17 and have no family history this disease is very frustrating😢😢

[@avyaktgodlyversions5089]

I'm 22 yrs female having this disease ☺I will kick it out very soon 💪✌🤘

[@satyampandey8470]

Yeah we are the Rheumatoid warriors... 🙏🙏

[@factsandknowledge72]

How are you doing now?

[@abcxyz4238]

Kya aap thik ho gye ??

[@nithishajain7592]

I'm 21, fighting against it too. What treatment are taking ?

[@abcxyz4238]

@@nithishajain7592 Aap kidhar se ho ?? Aap aayurvedic treatment lelo jaldi se jaldi

[@nooraali4499]

Great explanation

[@PhiloEnas]

Drpleasegivemesomemedicineiwatchyouonyoutubeihavegapinlegvatswellinginlegfeetswellingankle

[@PhiloEnas]

Yourresepisnotgivingtotalk

[@rashidansari4459]

Very very thanks sir

[@vinodraghav1552]

The explanation is wonderful. Thanks for the knowledge

[@madhvisrivastava5212]

Bahut sahi Ilaaj bataya aapane

[@jbjb1965]

This medicine helps temporarily I think constitutional medication is required

[@veeragowadia967]

Best ever explained dr.thanking you

[@YashHomeopathicCentreJodhpur]

My pleasure

[@sadhuramsharma1135]

Sir kya all medicine is required to be consumed daily as told by you.

[@savitakaviraj9522]

Thanku so much Sai ji 🙏

[@Lofisavan-yt]

Nicely explain..thanks sir..

[@ridhhirane7895]

There's definitely a reason to why I came across this video on KZbin: kzbin.info of Jyovis Ayurveda and I was very happy to see the results. I even followed few of the tips explained and it actually worked. Then I finally decided to contact on ...... ([phone]) to cure my Problem from the root cause. The team really helped me a lot. Thank you Jyovis!

[@heerachetry8122]

Thanks a lot 🙏

[@neev108]

Sir.. Can you please make a video on Spinal Arthritis ? My friend has lower back ache, and Doctors have diagnosed him with Spinal Arthritis. Please guide.

[@travellover1005]

Go to spinal injury center in Delhi vasant kunj best hospital for spinal injury

[@ridhhirane7895]

There's definitely a reason to why I came across this video on KZbin: kzbin.info of Jyovis Ayurveda and I was very happy to see the results. I even followed few of the tips explained and it actually worked. Then I finally decided to contact on ...... ([phone]) to cure my Problem from the root cause. The team really helped me a lot. Thank you Jyovis!

[@paravindarchauhan1727]

I am also suffering from this spinal arthritis

[@deepanshusaharawat8253]

@@paravindarchauhan1727 kitni age hai bhai teri

[@rajind2573]

Thanks Dr!

[@YashHomeopathicCentreJodhpur]

Welcome!

[@manishkharbanda8424]

Back and neck stiffness can also be possible in R A FACTOR POSITIVE

[@prasadstudiossurat5731]

Aap mere anubhav ki baath kiya ..he..muje..swelling aur inflammation nahi..baaki sub lakshan he..abhi ye RA heki nahi patha nahi chalrahehe..

[@ayeshajulekha6889]

@@prasadstudiossurat5731 ap rheumatologist se consult kijiye.

[@prasadstudiossurat5731]

@@ayeshajulekha6889 ha ji aur ek anubhav aapk ki saath share kar rahoo....ye R A wala daily khana me food me ..bina namak ..without salt ..bilkul nahi khake sirf 1.2 din dekhiye....pain me aur sub me bahut fair dikhega...1 saal aisa continue karegetho..RA completely cure hojayega..aisa anubhav wala bahut logo ne bathaya..sir abhi me 3..4 din se trykar rahoo..rath ko stiffness and pain numbness bilkulnahi ...baath ye he ki..man maarke swaad chodna pada lekin...vo dard ke saamne ye salt kuch bhi nahi....abhi me bina salt ka kaara hoo...

[@amrendrakumar90973]

Bahut bahut Good information Sir hame Rumetide Artherities hai aur main 2 month se Homiyopathic Medicine le raha hun par mere gutna ,Solder aur Hand Finger me dard rahta hai kya kare. Kya mai R11 aur R46 Reckwage ka le sakte hai sir mai Abhi R73 aur bahut se Homiyopathic Medicine Doctor ke anusar le raha hun.

[@sushimmukherjee9037]

Thank you so much . You are very kind and generous to share your medical advice .

[@buggubuggu6136]

Namaste sir Sir aapka bhut bhut dhanyvad aapki batayi medicine se meri allergic rhinitis puri tarah se thik ho gyi. Iske liye mai aapki bhut aabhari hu🙏🙏🙏🙏🙏

[@sattakinggalidesawer2959]

kzbin.info/www/bejne/m5jTo2iqgJ1lnsU गठिया का Free इलाज

[@MukulBerar]

Sir, RA disease me diet kya le. Please btaye

[@SahilAnsari-fs2tj]

Hello sister apko bhi ra hai kia bataiye na 😊

[@jayarayapudi4221]

🙏👍thank you Drji - very nice explanation about RA dhiya hai aapne

[@anil011250]

Thank you Doctor for the information. Any specific combinations available?

[@sevahospital2294]

COSTICUM 200

[@mdhidayath9968]

Excellent advice sir

[@surenderdhoundiyal0403]

Thanks sir V .good information

[@ridhhirane7895]

There's definitely a reason to why I came across this video on KZbin: kzbin.info of Jyovis Ayurveda and I was very happy to see the results. I even followed few of the tips explained and it actually worked. Then I finally decided to contact on ...... ([phone]) to cure my Problem from the root cause. The team really helped me a lot. Thank you Jyovis!

[@asishchakravarty3166]

Reumetoid Arthritis of very initial stage can be curable by Homepathy Medicine Sir Regards

[@mousumidey2235]

Is this ur own experience ??? I am an RA patient .. so I need to know this

[@asishchakravarty3166]

@@mousumidey2235 please let me know your mob. No.

[@vaibhavbhade2964]

@@ajaypradhan4877 hii bro I have also HLAB27 POSSTIVE

[@Pdv552]

I m also r a patient

[@Urbanindia745]

Please give me your phone number.

[@DhananjaySharma-kb7yf]

Its been 6 months... Please upload the video for the diet of rheumatoid arthritis

[@saavigl81]

Go to patanjali i had also 400 RA now its 50 around

[@abcxyz4238]

@@saavigl81 BHI mere KO abhi hui hai 1 month SE Mai treatment le RHA Hu natural AAPKi help mil Sakti hai ??

[@kaurbilkhu4515]

Im kids section patanjali sollution se kya sach mein kisi bhi type ka arthritis ka treatment jldi ho jata hai

[@mugdhashrivastava]

@@saavigl81 accha kya kiya tha aapne?

[@vaibhavjaiswal8342]

@@saavigl81 how it's possible

[@shaheenbanosiddiqui6221]

Sir aapka bahut bahut shukriya

[@YashHomeopathicCentreJodhpur]

😊🙏

[@sangitagolhar6491]

Thanku doctor

[@shalinisonisehgal1904]

आप का बहुत धन्यवाद डॉक्टर साहब बहुत अच्छे से आपने एक्सप्लेन किया आपने मुझे भी कुछ समय से शुरू हुई है यह तकलीफ और मैंने होम्योपैथी के डॉक्टर से ही इलाज शुरू किया है मेरी उम्र 45 है और मेरी नानी को यह बीमारी थी इस में आप डायट के बारे में भी बताए कृपया 🙏

[@anitapuriya3622]

Good information , thankyou so much, thik hone me kitna time lagta h dr.sahab

[@ibrahimansari8549]

Sir namaskar pls mere kandhe me jakran hai hath upar ke taraf uthaya nahi ja raha hai bahut hi taqleed hai pls vedeo load kare

[@ridhhirane7895]

There's definitely a reason to why I came across this video on KZbin: kzbin.info of Jyovis Ayurveda and I was very happy to see the results. I even followed few of the tips explained and it actually worked. Then I finally decided to contact on ...... ([phone]) to cure my Problem from the root cause. The team really helped me a lot. Thank you Jyovis!

[@samreenkaleem4162]

JazakAllah

[@mangalbhopale3913]

Nicely explained,plz make video on diet for RA positive patients

[@garimaswami149]

Mangal Bhopale what is your age ?

[@mangalbhopale3913]

@@garimaswami149 Hi...My age is 47

[@sagirshaki5615]

Sir ap dawai kuriyar se bhej sakte he

[@vaibhavjaiswal8342]

@@mangalbhopale3913 how are you now

[@tapash3918]

डाॅक्टर बाबू आप सही bataya

[@varunasaini1640]

So beautifully explained sir , hla b 27 positive par bhi vedio banaiye.

[@vanoldilip2339]

Mare same problem che ane su kevay

[@shekharjadhav7016]

Me too HLA B 27+

[@GeetaSharma-pz7mx]

Sir bilkul sahi kaha aap ne

[@saniasanober_yesofficer]

ya bimari bhut kharab h allha raham kara un sab par aur mera par bhi

[@mbapawanmehra1]

Shi kha....mujhe ummeed nhi thi ki mujhe hogi

[@mr.faeemahmad311]

@@Foodshow143 how it is possible please tell me

[@Foodshow143]

@@mr.faeemahmad311 do u hv rheumatoid ?

[@harishprjapati]

@@Foodshow143 I am suffering from rhuematoid arthritis please help me, I am suffering from this from 6-7 yrs...😞😞🙏🙏 Please help me...😞😞🙏🙏

[@Foodshow143]

@@harishprjapati don't worry

[@harshadpatil9820]

Is that periodically fever is the one of symptom in RA plz rply

[@sonadas9265]

Yes

[@parasgogia8793]

It all happens due to the Bad Lifestyle... And without a good lifestyle Product / medicines 💊 won't work... So if you are facing any health challenges like diabetes , BP, thyroid , cholesterol, hairfall, indigestion , joint pain , back pain, arthritis, asthma, Cancer etc... I would love to help you in an organic and natural way You can contact me at 8094887373

[@info2pragya]

Yes

[@vivekrajput6353]

yess bro i m suffering from RA and i fever is periodically

[@amandeepbhatia3492]

Thanks a lot sir🙏🙏

[@GYAAN_KA_SAFAR]

Thanks dr. I m also a rheumatic patient...how long will i get completly cure if i take homeopathy medicine...

[@positivelife8988]

Ab kaise ho aap 2 months baad

[@sudhanshushukla1728]

Aap ayurvedic se ise control kar sakte hai

[@krishnanandgupta5296]

Bahot bahot thanku sir ji . Aisa video kabhi bhi nahi mila hai .

[@ramakrushnanahak3885]

Sir can you make a video on ASO titre please? Kya daba leni chahiye high ASO titre patient keliye? Khane me kya parhej karna chahiye High ASO titre patient kliye please bataye..

[@kiransingh-ve4oy]

Aap koi dawa le rahe aso titre ke liye?

[@jagatram4325]

@@kiransingh-ve4oy q

[@sharifftradingview]

Good information sir all details are related to me ...

[@chrissymarie7903]

I wish this was at least subtitled in English

[@ashutiwari9564]

Reply with your email address,ill translate into English about medicines only,rest he told about what is this disease and causes and thats very common need not listen to that

[@anuragiinspiration5936]

Sir aap bahut fast samjhate hai aap jo jankari dete hai ,bahut acche se samajh aati hai thank you for information,🙏🙏👍👍💐💐💐♥️

[@cookingwithzoya]

Mujhe 2 years se arthritis ka problm h..koi aisa medicine btaiye jisse ye hmesha k liye thk hojaye

[@abhishekjaiswal5850]

Ji mam esi koi bhi medicine nhi hai jo cure kar sake ha Lekin gharelu upyog se thik ho jaogi aap

[@iqrafayyaz1531]

Abhishek ji....Kiya ghareku uppay bataye?

[@rishusharma85]

Joya Khan ji yes aapka ye bilkul theek ho skta h u can contact me on 7986705956

[@rishusharma85]

@Rajinder Kumar whatsapp kriye 7986705956

[@chhipahuasatya8773]

Gathiya or joint pain fully cure call Dr Satish Chand Ayurvedic 8218857659

[@sarikasingh5614]

Great explanation sir.

[@ashoksuna6030]

Thank You Very Much Sir

[@diannelariviere9518]

I’m very sorry Dr I would really love to know what you say but I don’t understand please will you say all that in English You are one beautiful mann

[@yamdootthemessenger3472]

Start translator apps...hindi to english 😜

[@parasgogia8793]

It all happens due to the Bad Lifestyle... And without a good lifestyle Product / medicines 💊 won't work... So if you are facing any health challenges like diabetes , BP, thyroid , cholesterol, hairfall, indigestion , joint pain , back pain, arthritis, asthma, Cancer etc... I would love to help you in an organic and natural way You can contact me at 8094887373

[@tilakmandaogade8621]

बहोत बढिया माहिती सर..

[@sandeepkryadav3269]

Sir I am suffering from RA .I am 19 year and this problem is about 8 year old in my body .sir please make video on diet and exercise for RA. Thanks sir

[@manishjain337]

Bro... Aiims delhi dikhao... Vha pr best doctor h.... RA KA DEPARTMENT BNA H

[@mayurpatil3676]

Brinjal , guwar , aachar , lemon ,emli te avoid kro bro.

[@seemajat-vl3zd]

sir meri age 22h or muje arthraitis h or me treatment le rhi hu lekin abhi tk jyada aaram nhi h plz sir aap sugest kro ki kya kru

[@kajalkhan1569]

Seema jat ap kon sa treatment le rhi h mjhe b ye bimari thi but ab m thk hu

[@Luckymind12]

@@kajalkhan1569 Which treatment you take homopathy or allopathy?

[@Luckymind12]

@@kajalkhan1569 From where u take treatment and is it continue till now?

[@kajalkhan1569]

@@Luckymind12 Delhi m rehti hu m or yhi s treatment kraya h do saal dwa khani h bs ek saal hogya ek saal or khani h bs

[@Luckymind12]

@@kajalkhan1569 ok thanku😊

[@kartikbiswas4092]

Very nice Sir, God bless you

[@kkmandal364]

Thanks sir! Kya A. S. O. Positive patient ka Sahi treatment homeopathy me hota hai? Please tell 🙏

[@sonamkumari-gg6ml]

Mera v aso positive h kon sa ilaj le rahe h

[@kkmandal364]

Peniduer 12lakh injection 20-20day ke bad

[@koundinyamurthy4225]

After taking sulphur 200 , when medorium 200 to be taken (time days gap) and subsequent medicines. Pl reply sir

[@mohammadtanveermugal8271]

Best information sir

[@notablesolutions4u]

"...a high percentage of RA patients have systemic mycoplasmal infections", per the US National Library of Medicine National Institutes of Health.

[@Itsonlyvijay]

Sir contact me my mother suffer from it 7087971196

[@bhagwansinghrana8224]

I started having symptoms of Arthritis just after extraction of my molar tooth, how to treat myself ? Plz suggest

[@bhagwansinghrana8224]

@Ritu Yadav I could not contact You at Your given number when I tried but you can leave message at my whatsap number [phone], I am from Nepal

[@bhagwansinghrana8224]

@Ritu Yadav Plz whatsapp me at [phone] or email me at [e-mail]

[@mercylopez5181]

Appreciate video content! Apologies for the intrusion, I would appreciate your opinion. Have you considered - Schallingora Complete Resetting Scheme (probably on Google)? It is a smashing exclusive guide for curing arthritis minus the hard work. Ive heard some super things about it and my mate at last got cool results with it.

[@sanjuktamohanty1824]

I am sanjukta Mohanty mera remuatic arethates mera phone number 8114344673 WhatsApp number same your medicine KZbin me dekha if am I will eat?

[@sunilphadke178]

Very good information...

[@deliaaguirre4547]

Hi Sr can you please tell me the remedy in English thankyuo 🙏🏽🙏🏽??

[@fakku6356]

You can take Prednisone and it will help you a lot almost to the point where you will be happy you should try it

[@randheersingh2709]

A clinical immunologist can treat this disease better. A salt "mithotraxate" is given to treat it with pills of iron and folic acid. Steroidal drugs may also be given for a limited period of time. I myself have been patient of this disease. Now I am free from the disease and my medicine have stopped. I got my disease treated by Dr Banwari Sharma Clinical Immunologist Niramaya Healthcare Jharkhand Mod Khatipura Road Jaipur (India) To get appointment Contact him by e mail : [e-mail] Best of luck.

[@anitaanitadevi1806]

Right sir

[@harshadpatil9820]

These all medicines have any side effects

[@divinelove8917]

No

[@jogindersinghkaundal9681]

I suffering from joint pain, neck pain,backache,shoulder pain, nose polyps,hameorirde 1 grade,prostatic grade 1, kindly suggest medicines for this. I am thankful to you.

[@lifewillow2612]

Sir merko arthritis ki problem ha sr meri finger Tedi ho gayi ha

[@zalasavdas8692]

9979533255

[@ayeshajulekha6889]

Consult a rheumatologist first.

[@paravindarchauhan1727]

8887869234

[@venniealmeida7000]

Very nice good explanation thank you very much My husband is suffering from ASO pl forward me some home treatment

[@parasgogia8793]

It all happens due to the Bad Lifestyle... And without a good lifestyle Product / medicines 💊 won't work... So if you are facing any health challenges like diabetes , BP, thyroid , cholesterol, hairfall, indigestion , joint pain , back pain, arthritis, asthma, Cancer etc... I would love to help you in an organic and natural way You can contact me at 8094887373

[@morevishal.9921]

जिसे होता है ये बिमरी असे ही पता

[@abineshawaz336]

Thank you 🙏 I will go for homeopathy. Only homeopathy can cure this desease.

[@Mitthu0855]

Mam homeopathy se apka thik hua

[@abineshawaz336]

@@Mitthu0855 bro your email I'd plz

[@madhuswetta3913]

You are confusing with so many Medicines Dr...

[@parth3278]

Flexibility kam ho gaya ha joints me solution????

[@deepumadhu5766]

same prblm

[@CMTPAINRELIFHERBALMADURAIMThom]

@@deepumadhu5766 pain relief herbal oil available contact courier available 9047069711