THIS IS THE SCARIEST FAZBEAR’S FRIGHTS EVER... FNAF The Horror Attraction by Battington

Leave a like if you enjoyed today's video! Lots of love!
• The Horror Attraction
Become a Dawkbro!
hex.store/
/ dawkosgames
/ dawkosgames
/ lewis_dawkins
USE CODE DAWKO AT GFUEL CHECKOUT FOR A DISCOUNT! gfuel.ly/31AcTEM
Discord: discordapp.com/invite/dawko
MERCH: dawko.teemill.com/
NINDAWKO - / @nindawko
Join this channel to get access to perks:
/ @dawko
#fivenightsatfreddys
#fnaf

[@Battington]

Thank you so much for the support! Big shout out to everyone who contributed to the video.

[@Boigbauttp]

Where is the behind the scenes

[@amanammer]

everyone did an amazing job!

[@graffivids2460]

Yes come on, how did Dawko not find and pin this?!

[@MonkeyOnWheels72]

Great job battington!

[@yeahok8259]

Awesome work as usual man!

[@feral0549]

Anyone notice when Phone Dude announced during the ride he mentioned a Code Yellow? That is typically for gas leaks or chemical spills. George could have been hallucinating the entire time, driving him mad until he eventually gets hit by the cart.

[@corruption2681]

Code yellow refers to a missing person, george was the corpse referred to at the beginning.

[@corruption2681]

He started existing out of time.

[@aldiascholarofthefirstsin1051]

Don't spread misinformation.

[@feral0549]

@@aldiascholarofthefirstsin1051 Just a theory.

[@aldiascholarofthefirstsin1051]

@@feral0549 It's not a theory, it's literally a wrong fact.

[@Horroraddict666]

maybe George was the "Dead person" that was rumored in the beginning by his friends, his soul was grounded there in that loop and basically in the beginning it actually happened before he died BUT when Vanessa was screaming for him, she was screaming for someone to help her because George died🤯

[@ParanoidHunters]

That could be. He could be assumed dead since they didnt find him. Kinda like no clipping.

[@Horroraddict666]

@@ParanoidHunters true!

[@THICCsuki]

I like the theory, but what is understood was referring to Springtrap

[@WildcatGambit]

i rly like this idea, no wonder he couldn't go with his friends at the beginning!

[@Horroraddict666]

@@WildcatGambit thanks!🫶

[@MoltenVR_]

Neat little fact, ever time George goes down the drop, the cameras time go's back too 24mins, indicating a potential loop in his mind, maybe because he may have passed out during the first malfunction. This can possibly be further proven when he says: "This most likely isn't real" Edit: The comments be wild

[@Iguanodon-fb7rs]

lol Hazbin fan spotted

[@1orenzius]

"hell is forever whether u like ir or not" 🔥🔥

[@Black_Gru]

Meh, Hazbin was completeley mid. The things that ruined it the most is the pacing and the kids watching it….

[@Iguanodon-fb7rs]

@@Black_Gru I loved it

[@SleepyKnight-sx7po]

Also his battery fills back up

[@_shelby.mason_]

"imagine the SMELL?! that's so DisGUstINg" with the voice had me so dead💀

[@MrSprings355]

Like the way she said it had like sassy girl 2000s vibes

[@jfdgbfjlttkntg]

i love it

[@Frozzfire_Blackheart]

He sounds one of those tik tok material sassy gworl (even tho i dont like those people but i love how dawko just use that voice for out of context)

[@HarmonyHowlette]

Sounded like dawkos voice for Monika in his ddlc playthrough

[@KingGodzillaTM]

Valley girl accent yeah pff

[@thefantasticretroreviewer3941]

18:49, If I saw THAT freaky thing in the same spooky Hallway, I'd be so scare and run so fast that I would make Superman, The Flash, Road Runner, Speedy Gonzalas and Speed-Buggy look like slow Snails.

[@ParanoidHunters]

Just stay off the tracks you be good :)

[@thefantasticretroreviewer3941]

@@ParanoidHunters Seems like decent advice to me

[@bbseal]

what about sonic

[@thefantasticretroreviewer3941]

@@bbseal Him too

[@shadowphantom5407]

what about quick sliver?

[@Immortal_Ninja]

My guess is that George got stuck in a pocket of time after he got on the ride and thus time would naturally pass while George was stuck in the looping ride. By the time he "escaped", he was in the dead and dilapidated location that had been evacuated during a police investigation.

[@ParanoidHunters]

I think vanessa is some sort of trick as well.

[@SymphonyOfTheMind.]

I thought this too, seems the most oogival

[@MannequinMonarch]

That or he may have very well still been in some form of alternate reality or pocket location. I personally like to think about it like if FNaF had it’s own take on the Upside Down or Back Rooms. Entirely isolated, making it even scarier for anyone inside. Also means his body would NEVER be found, much like the poem in the original video’s description describes. Though that’s just my theory/head canon, I just like that idea as it is way more chilling and scary to me, the isolation and helplessness of it.

[@bradley2468]

This reminds me of into the pit

[@kingcleeetus3587]

Freddy Fastbear

[@GooberProducer]

Fried rice at dennys

[@whocaresaboutthename6850]

Har har har har har har har (Green Hill Zone Theme).

[@PurpleBoi69]

According to his Girlfriend

[@izvayl]

@@PurpleBoi69hello

[@THE_222]

@@GooberProduceris this where you wanna eat!

[@JessRedMusic]

The detail I love about this is when he goes into the drop, you can see the timer on the camera go back to the 20 minutes. To show that he did go back in time to relive the ride over and over and over again

[@ParanoidHunters]

I wonder how long he was there. Two - three hours?

[@Candy_Kitsune]

Feels like a reference to when you shoot Helpy in Foxys Pirate Adventure. It goes down a path that you're not meant to say and then goes back to the beginning

[@Electricstarzsh0ckt0533m3]

The fact that it says “HurricaneHaunt”, it felt like it’s connected to the Novel trilogy

[@thegodzillafandomsrookie5514]

or its just because both the series and games take place in hurricane utah

[@MemeReviewer]

Surprised Battington didn’t register a domain for that

[@addison_v_ertisement1678]

​@@MemeReviewerDomain Expansion: Hurricane Haunt.

[@Reseptics]

​@@addison_v_ertisement1678why does this actually go hard?

[@MemeReviewer]

@@addison_v_ertisement1678 yay!

[@ElizabethLopez-un8ow]

Out of all the vhs tapes this one was the most unsettling one too date

[@Your_everyday_Weirdo667]

Yeah,I couldn't even watch it on my own,it felt to unsettling to even watch on my own in the day,I only got as far as the third loop before I felt too unsettled to watch😅

[@iimd_pll]

fr dude 😭idk why this one was just so scary, i had to keep pausing

[@tm0410]

18:49 I love how this is a reference to golden freddys head in the hallway in fnaf 2, I remember being terrified the first time I saw that in fnaf 2

[@kaIamos]

Wait a minute, George's friends said a body was found on opening day. And we can tell that George is time travelling because of the time on the camera, so what if George was brought to the opening day and became the corpse found on opening day?

[@anothernrg8274]

Most likely, We NEED DAWKO TO SEE THIS, everyone, Like @kalamos 's comment!

[@gamejitzu]

I haven't seen an idea like this, yeah it could've been really clever seeding. And if the black goop from Golden Freddy was agony, combined with time travel, this is like an Into the Pit situation Edit: oh :v

[@Yayofangamer16]

The description of the video debunks this

[@kaIamos]

@@Yayofangamer16 Hence the what if.

[@aldiascholarofthefirstsin1051]

@@kaIamos What if I made a theory that is completely wrong and then act like a coward when I face absolute facts that debunk it.

[@sushifox0]

My theory is that he DID go in, but the sort of “loop” that he was put in didn’t share the same time as the outside world. I could also see the use of illusion discs playing into this animation, but maybe I’m just yapping lmao

[@ParanoidHunters]

Somthing going on for sure cause that ride became somthing else.

[@e-pointer2262]

Nah illusion disks make sense unless the ride really does have a shtick of feeling like a loop

[@lmaobox4068]

It's good to note the areas that the giant golden Freddy head and black goop appear in are the only areas not affected by the building’s blackout Illusion disks deactivated in most of the building except for those areas explicitly with power?

[@GlitchyBoy64]

1:50 Dawko really went 😜💅👄💀 (The eyes in spring bonnie from the fazbrar frights logo send chills down my spine)

[@ParanoidHunters]

yeah it is crazy

[@egg_head_defore]

its a good design lol.

[@THICCsuki]

I love that design too

[@ashtrro]

I genuinely felt this anxiety while watching this bc typically in horror it works best when you feel for the protagonist and he just did not deserve that lol

[@ParanoidHunters]

Yeah it gets worse and worse.

[@kory_misun]

Xander's voice acting was absolutely fantastic. I was genuinely afraid for him once things started twisting and becoming more dire.

[@ParanoidHunters]

It was very good. I thought the guy was a bit crazy but then im like yeah this is a bas situation.

[@kory_misun]

@@ParanoidHunters Yeah, we're not told how long he's stuck in there for. I'd become unhinged pretty quickly if I couldn't get out and no one came to find me. Meanwhile I know I'm not alone and the robots move.

[@Jumpyman_thegamerYT]

Notice that the time on the camera footage actually goes back each time. It keeps re-setting. This time just shows how long he's been recording for, and isn't what the time currently is obviously. Meaning that the time loop is physically altering the camera footage itself.

[@ParanoidHunters]

Yes and the power as well.

[@giuliobros.123]

Battington really knows how to make things terrifying

[@ParanoidHunters]

super terrifying

[@kendgie_245]

When it said code yellow (aka, a missing person) I immediately was like, "Oh, George so got trapped in a time loop and is now missing"

[@tristanribeiro7903]

As I said in the comments from Batington's video, the concept could work as a potential new Fazbear Frights story : a loop where someone is stuck in an attraction, and can't escape. I love this video, Batington nailed it 👌

[@ParanoidHunters]

It was great. I would never go there lol

[@tristanribeiro7903]

​@@ParanoidHunters i mean, I'm sure that people are clever enough to avoid places like this for urbex.

[@Marshmo]

Battington never misses, I love videos like these

[@ParanoidHunters]

This one is so complex. Could start doing full movies soon.

[@Crystal_959]

I don't think the protagonist was hallucinating. Every time George loops back to the start of the ride, the camera's display jumps back to how it was when he entered. We're watching through the camera's perspective, not George's. He got sucked into like, some weird pocket dimension or something. It states in the description that no one ever found him no matter how hard they searched

[@pupulauls]

Code yellow is typically a code for a missing person. George goes missing part way through the ride and is the reason it stops. The ghost of Springtrap somehow makes his body disappear while he torments him in a loop. He almost acts like Pennywise in this video, and spends most of the time making George more and more scared like the more fear he has the more satisfying the kill will be. Might be on purpose considering Georgie is probably the most famous victim of Pennywise. Also I love the big Golden Freddy head as a reference to FNaF 2 as well as the broken Toy Animatronics

[@NekoPatty06]

That giant head made me stay up all night because of how terrifying it was

[@Cruisvfixz]

18:48 "You want fun?" "Fredbear will show you fun"

[@Yumais]

Scott needs to hire Battington asap, his videos are just too well done and he's too talented to go unused.

[@yeahok8259]

Yeah! And not even just because of his editing/modeling skills, but the dude is a very talented writer/director

[@aldiascholarofthefirstsin1051]

Hire him for what? The video games are real time 3D, there is nothing Battington can do.

[@Tarokun874]

21:13 George: WHY WONT YOU LET ME LEAVE springtrap: answer: ATZJDDKHTSKSKRGFHKWSHFKKHFKWWFSHRLHRSYRSRTSRHSRMYSHRS i mean he has a point

[@Orange-inkling]

Agreed

[@Xzyzkw]

At 16:07 you can see a shark animatronic at the right which I think is Felix the Shark which is a pretty cool easter egg

[@ParanoidHunters]

Thanks that was a cool find.

[@Xzyzkw]

@@ParanoidHuntersIt makes sense as well since presumably the SpringTrap used in the VHS was the one from the books.

[@thundertits]

I like how this one felt like a fazbear frights books

[@ParanoidHunters]

It did.

[@yeahok8259]

I commented the same thing on the OG vid! I wish more creators did stuff like this

[@F1ZZYFAZZ]

19:12 well,, Afton sure knows how to make a horrifying entrance 😭

[@ThatTazVEVO]

From what I think there are a few reasons to why the ride repeats and then kills George: 1. Springtrap uses the illusion disks to trick and alter Georges perception to make it feel like he's repeating the line over and over, which I think is cool because it turns Springtrap from a basic killer in suit to like a Mysterio from the Spider-Man comics; someone who can alter others perception with basic smoke and mirror tricks to twist their minds. Maybe William Afton sees Mike in George so that's why he hunts him. 2. It's the ghost of the children taking back the ride that makes fun of their deaths, which there are multiple references to previous VHS tapes that only Mike would've seen such as Chica's lovely song, Foxy meets the happy man & others. So imagine the hate the animatronics feel towards the ride that pokes fun at their death but then again why would they target George for no reason. 3. It's a farm for Remnant made by followers of William Afton. I'm saying this cuz there's references to Glitchtrap on the wall in the FNAF 2 room and one of the characters being named Vanessa. This is the most far fetched theory but imagine if followers of Glitchtrap created a harvester of Remnant (I have no idea how Remnant works I'm just guessing you get it via Monster's INC style but more people's death's not just their screams).

[@aldiascholarofthefirstsin1051]

4. The yellow rabbit has reality altering powers, something that people really don't say for some reason, despite the other incredible parts of the story such as robots inhabited by ghosts.

[@slimeezpizzeria]

this is honestly my favorite fnaf vhs tape i’ve ever watched

[@ParanoidHunters]

This one had a lot going on.

[@bubblepopva]

Thank you so much for reacting, Dawko! I had a blast voicing Vanessa and Jessica! ❤❤

[@jakecookie5448]

Being trapped in loop is something scary to be in especially when something alive in there while watching friends get killed in there😓

[@ParanoidHunters]

The guy is legit upset. I would be as well.

[@JiggyThe1st]

1:50 Never knew I needed Zesty Dawko in my life

[@ParanoidHunters]

Zesty Pizza Dawko possibly?

[@balls2132]

Dawko has a good voice impression 1:50

[@SStickystickk]

“iMAgiNe the sMeLl, ItS DisGustiNG”

[@ParanoidHunters]

Or it smells like pizza

[@AshishXMC]

The Huge Yellow Bear Head is basically me when I am about to have a bigger size of my favorite food.

[@ParanoidHunters]

And then a rabbit comes out? :D

[@AshishXMC]

@@ParanoidHunters Yeah, I guess when I eat an egg sandwich, but they used boiled eggs, having no idea that whatever was forming inside before, was already formed.

[@leonardoleal3526]

Oh my gosh. What a freaking animation, the sound, the animation, the ambient. Everything about this video is so creepy and so fnaf like. Props to battington and everyone who helped make this video.

[@ParanoidHunters]

They should start making full movies.

[@leonardoleal3526]

@@ParanoidHuntersyeah that would be a awesome idea

[@MikyYT]

Springtrap really toyed with his pray

[@thefantasticretroreviewer3941]

Is it William Afton still stuck in that Suit?

[@MikyYT]

@@thefantasticretroreviewer3941 DUH

[@thefantasticretroreviewer3941]

@@MikyYT Just making sure.......and even in the Suit he is scary

[@marcee1487]

I didnt know afton was religous.

[@DedBoyRyan]

@@marcee1487For real.

[@bluegold1026]

Love all the callbacks to Battington's previous works. Also, the plot of "The Horror Attraction" would fit right in as a short story in a Fazbear Frights book.

[@wafagdplqs4421]

I always loved fans interpretation of Fazbear Frights because we've never much of the actual attraction in the games. And of course Battington would be perfect for this !

[@NifftyTheKiller]

i love how dawko said “tHeReS ya WaRnInG 😂😂😂 dawko is the absolute best person i really hope he gets invited to the fnaf 2 movie set he deserves it 🩷🩷🩷

[@ParanoidHunters]

If 2 is a prequel that might happen

[@mightbealvi]

This could actually be a good ride for Universal Studios

[@scottypenguinGaming]

youre insane metoo😂

[@kudvin101]

i love how everytime he loops the video time goes back to 24 minutes, it's a nice little detail

[@rubykaylaandogie3334]

"GET ME OF THIS RIDE!!" "Please excuse me sir but would you please escort me from this simple train made for ones enjoyment?"

[@Wafflefries-wi5rf]

I have a theory, when he was going back in time years and years past outside the building and it only felt like minutes for him and the reason why police were outside is because his friends must’ve reported it to the police.

[@No_James_Here]

I was 13:59 in and I got an ad for Chuck E. Cheese, coincidence?

[@ParanoidHunters]

they know!!!

[@Thekrineyesyes]

I would like to point out how when he goes back to the start, the recording length reduces to the same length when he went on the ride in the beginnin. Also the fredbear head that spat out springtrap could have been a phantom. Otherwise amazing vid❤❤

[@ParanoidHunters]

Good eyes man

[@PaulIsntMyName]

I was waiting for you to cover this 💪

[@bigpoggers6507]

Theory: The loop is slowly showing bits of what actually happened to George, he was lured by the spirits into the tracks where he got hit. The "loop" is his memory of the event repeating over and over, distorting and twisting as he dies. The time on his camera resetting is from the memory restarting, with every "Springtrap" instance, when pieced together, displaying what actually happened. He gets on, he goes on the ride, he gets stuck at the section with the toys, the spirits use the Springtrap animatronic to lure him into the backroom, he runs out, with the Springtrap animatronic continuing chase until eventually he gets cornered at the start, causing him to run backwards, where he gets absolutely mollywhopped by a cart. The "turn back" from the Puppet being a warning to not enter the toy room as that's where the backroom entrance is.

[@elephantality3753]

True, the Freddy Head could have been what he imagined as he was hit by the Freddy Cart. The turn back, I think is just the Puppet telling him to wake up and live... Maybe.

[@aldiascholarofthefirstsin1051]

Why do people like those boring-uncreative-absolute and objectively garbage dream theories? Is it so hard to you to accept the ghost robot bunny has the ability to put the guy into a time loop? Or a pocket dimension?

[@elephantality3753]

@@aldiascholarofthefirstsin1051 Doesn't seem likely especially when he leaves and magically is in a cart again. No to pocket dimension.

[@aldiascholarofthefirstsin1051]

@@elephantality3753 But yes to time loop, right?

[@coleminer8847]

A small detail The timer in the top left resets to the time it was at during the start of the ride every loop

[@zaknorris2653]

This is genuinely so cool! The idea that Springtrap is hidden amongst a bunch of animatronics posing as him is so creepy. Especially cause George doesn't even know Williams inside

[@datemmie]

its funny that the video itself is 23 minutes while fazbear's frights was theorized (idk if its canonical) to take place in 2023

[@ParanoidHunters]

I bet he was there for hours.

[@datemmie]

@@ParanoidHunters to me, it seems like years.

[@gavinjames645]

At this point battington should make their own fnaf fan game 😅.

[@xcheeltroncoso2002]

I know, right! Can you imagine how it would look like??

[@fried_fries]

He definitely makes really good analog horror videos, but I don’t know if that would really translate well to a game tbh

[@xcheeltroncoso2002]

@@fried_fries oh well, a person can dream.. 🙃

[@ShadeauxMan]

Universal should seriously do something like this! They already have so lit rides! Like the Transformers one! This would be amazing’

[@ParanoidHunters]

Yes but way less scary lol

[@ShadeauxMan]

Nah, it’s gotta be terrifying🙏🏻

[@Timeless_fnaf]

i LOVE the vintage 90's synth horror vibe in that beginning commercial so much. If fazbear freights was real it would 100% look like that.

[@smoresx]

Did you know when the phone guy said code yellow when it first broke down code yellow means a missing rider alert

[@AlexLazee]

I love this VHS so much.

[@AwkwardCat23]

Battington my beloved i love his stuff SO MUCH it is my favorite fnaf vhs content, one of my favorite and most quoted videos on the internet is made by him

[@ParanoidHunters]

I am glad to see a new one

[@nothingrhymeswithorange5294]

That thumbnail makes Dawki look like he's in an early PS4 game

[@ParanoidHunters]

Dawki? lol

[@tkmikki]

they said at the beginning of the video that this was at the washington county fair (which is the actual county Hurricane is in), and I've been there. If this was at the county fair, I would be shocked because, at most, they usually just have like your basic ferris wheel, the one spinning ride, a carousel, and then food and games. not even a spooky ride or tunnel of love. also, props to battington for getting the va for the advertisement at the beginning to say the town name right (its pronounced "her-a-kin")

[@bumblefilm]

this really reminds me of the one stargate sg-1 episode where jack, teal'c, and daniel ended up stuck in the same time loop and you can really genuinely see the insanity start to set in, but with a big lack of self awareness. Out of all the tapes battingtons made this has got to be my favorite!!

[@ColorMidEditz]

Maybe with the drinks he had he hallucinated the place not being abandoned and most likely passed out during the malfunction, waking up to the abandoned place, which was most likely an infinite loop setup by Springtrap. I don’t have any theory about the friends and the big fredbear head.

[@elephantality3753]

I do. So if we assume he was hit by a Freddy Cart, I think the Freddy Head was what he imagined as he was hit. The blood? His blood, upon being mangled by the cart. Vanessas screams? Her finding George hit, and he understands half of it and as it distorts... his consciousness fades away. I think SpringTrap killed him at the drop, or he died in the room with the malfunction. Also to note, he was the last ride of the night.

[@aldiascholarofthefirstsin1051]

@@elephantality3753 Garbage theory.

[@yeahok8259]

This is why I love Battington. Dude is genuinely creative- and the extra detail of green-screening himself into his animations for better human realism is top tier editing as well.

[@PELTIER5]

Maybe he died on the ride back then and is now stuck in a sort of hell cycle

[@ShadeauxMan]

Also- I’m probably not right.. but what if George is the one that died- and he’s reliving his death repeatedly-

[@ParanoidHunters]

Yeah it feels like he is the one that is dead. Kinda like he no clipped and is seeing stuff from the past as he is trapped.

[@SarahAbramova]

It's so cool how people just create so many games/videos based on this one franchise!

[@ParanoidHunters]

It is cool. i like it a lot.

[@breakingfaffles]

this whole video felt like a Fazbear Frights story, it feels like the first time reading one of them again for the first time

[@magna-zone1219]

My fav part about battington is how he destroys your preconception of what FNAF is and can be

[@juliane.mfarias9285]

Battintong made the giant Golden Freddy head in the hallway terrifying!!

[@larrythestoner2449]

Battington has once again made a masterpiece with his animations! I absolutely love the amount of detail, acting and story he does. I hope he does more in the future.

[@gbird.]

it would be cool in universal BUT this has clear inspirations from Disneyland haunted mansion/pirates

[@ParanoidHunters]

Needs more water.

[@BlueToons925]

The first time I watched this it scared the hell out of me, glad you enjoyed it too!

[@TacoQueen33]

Battington has always been so good. I adore their FNAF VHS tapes so much!

[@btsfan459]

I absolutely LOVE looking at the VHS tapes from FNAF, I love seeing people's creativity, and I've seen some REALLY good ones, they're so cool to look at, and honestly makes me believe that they're real just because of how awesome they are. Love you Dawko, you're an inspiration for me, and really appreciate what you put out to the world 💜💜💜

[@ParanoidHunters]

I bet a lot of time goes into the story telling than the models. Have to get each shot right over and over.

[@btsfan459]

​@idHuntersExactly! I agree, the fact that people put so much time and effect into these videos is insane, I love how dedicated people are lmao

[@BatoonyPants]

Every time he goes down the drop, he could’ve blacked out and when he woke up, William afton kept putting him back at the start, and every time he woke up, he thinks the ride keeps looping, draining his sanity. And by the time he finally gets off the ride, it’s a different year, and he finally gets killed.

[@_lauragull_4178]

I was waiting until you posted your reaction!! Battington is so talented😭🔥

[@ThatOneRandomPerson54]

This whole tape seems like one of the book stories, like in the Fazbear Fright’s series- Crazy!

[@gavinjames645]

Dawko if you look at the time during the ride it restarts every time he goes down the fall.

[@ParanoidHunters]

Yeah it goes back like 20 mins

[@ParadoxCore18]

Finally! So happy that you reacted to the new battington video!

[@runningthemeta5570]

Hell yeah, I saw this and it was so good. I was waiting for either you or Ryan to react to this.

[@DerKaiserMann]

Battington is great at making these locations feel actually haunted, not just the animatronics. FNaF Plus Break in had it down perfectly is what I thought before I saw this

[@xaviergarcia5421]

This was really well made. I cannot wait for more battington or other reactions

[@StinkySandism]

this whole thing gave me goosebumps vibes

[@Tarokun874]

1:50 PERFECT 👌 IMITATION

[@facely]

I don't understand how he gets transported back to the ride car when he tries to run away. He doesn't even really comment on that when it happens. I'd be beyond freaking out.

[@elephantality3753]

That to me suggests limbo

[@limegreenlive7813]

Since George time goes back to 24 four times I've been able to give you the real time he spent in that ride. In reality George spent 1 hour, 23 minutes and 41 seconds...

[@Dani-yo]

WHY WONT YOU LET ME LEAVE?! RRRRRRRAAAAAAAAGGGGGGHHHHHHHHHH

[@ParanoidHunters]

I wonder how long he was there for.

[@katiesherman6517]

It feels like a Fazbear Fright story! Good stuff!!!!

[@fireboytheone]

honestly, i didn’t even notice that the time on the camera resets on each loop on my first watch through. such a cool detail.

[@OdensMovieMagic]

Wow.

[@gigachad6384]

Yes

[@ur_l0c4l_n0nbin4ry_k1d]

I find it funny, a freind of mine did a FNAF DND thing for Halloween (they were the dm, it was really fun) about Security breach having a halloween special where we get locked in and everything goes wrong. I really like the way Battington made the video, it was really cool and well made!

[@puppylover4865]

I was waiting for Dawko to react to this because he makes it a less terrifying with his reaction and commentary 😅.

[@Catnap-creations]

I always look forawrd to when dawko posts Love you Dawko

[@ChaoticMysteriousEntity]

This was an absolutely insane experience and unbelievable phenomenon 🎉 Loved It 🖤 Can’t Wait For What Comes Next!

[@JoaoPedro-ol7sl]

I think the body mentioned was that person from the other video and he could have died on the first time waiting maybe that's whh Vanessa screams bc she found out he died, or it was springtrap mocking him.

[@Rockystan675]

YEAHHHHH I WAS WAITING FOR DAWKO TO REACT TO THIS VIDEO LETS GOOOO❤❤❤❤