Shadow the Hedgehog | SnapCube's Real-Time Fandub

[@PragmaticProsecutor]

I love how Ryan can only think of 3 sins and 2 of them are adultery

[@biomecraft356]

And then finishes it off with saying "Thou shalt not covet other gods" or something like that, which is ironically what Shadow has been doing this whole time.

[@Jonahmation]

⁠@@kenn_k All of them are adultery, lmao

[@weezarddd__]

S E C S

[@FlareStorms]

​@@weezarddd__A singular seck

[@asterisk5054]

I've come to make an announcement

[@Actiondanny]

I just really like how The Devil (from The Bible) said "most actions are sinful" at the start of the video, and then spent the entire rest of the story going, "not that, though."

[@lachlanmcgowan5712]

Yeah that's because Shadow is really bad at sinning

[@lunarskys2645]

"You could become an intern for Disney..."

[@demonking3673]

Disney is the biggest sin company

[@ABANDONED23456]

Dont you mean *_the Bibble?_*

[@MigattenoBlakae]

He DID say he was good at gaslighting…

[@Whiteythereaper]

80% of Chase's dialogue is just "Hey" and "I'm the devil" and it's so good Also "from Da Bible"

[@reubenfromow4854]

My like took you up to 666 so it was my civic duty

[@Dr.Hakase]

they also add "from the bible" as well lol

[@themodernguitarist]

FROM DA BIBUL

[@elementalgamer0732]

Bing bong

[@Seba12322]

From Bible

[@Meteorite_Shower]

*_HEEEEEEEEEEEEEYYY, WHAT'S UUUUUP, IT'S ME, I'M IN YOUR NEW GAME, SHADOW. I LOVE YOU_*

[@AaronAkioTheBraixen]

STOOOOOPPPP!!!!

[@sonicspider21]

I…I don’t know how to impress that upon you that physical damage done to my body does not affect me in the long term

[@red5158077]

"Cool? I suppose?"

[@sonicspider21]

“Can I have one for personal reasons? Not what you think though! Sicko!”

[@SonicBoss1991]

Remember me? The devil from the bible? I'm here to help the new generation claim sin points

[@owlbear2228]

The funniest part of this whole dub isn’t even a joke itself, it’s the simple fact that the cast completely ignores Amy in any scene she’s in.

[@Page153]

She doesn't even talk lol

[@WhiteWolfRQ]

I didn’t even notice that she was in scenes

[@ryanm.8720]

Fitting, since 'Sonic Destruction' implies that Amy was a ghost the entire time.

[@Zekken_The_Lodestar]

"WHERE DID AMY GO? SHE WAS RIGHT IN FRONT OF ME!!"

[@Saibachap]

@@Zekken_The_Lodestar "Hey reference"

[@PlebNC]

Eggman: "I am neither single or taken." Man, Eggman's relationship history is a ride in these fandubs. First he was married to a wife, then divorced, then got a husband, now is nebulously single and in a relationship at the same time.

[@sweesbees]

and he is in hell

[@dandyspacedandy]

you could say its... complicated

[@Noobgalaxies]

He's just speedrunning allgamemodes% in relationships like a true gamer

[@Dinoman972]

Maybe he still has a husband, but the fact he's a gamer means he's physically unable to be in a relationship, canceling it out and leaving him in a very nebulous state between taken and single.

[@trumpeterjen]

He's a polyamorous bisexual, too. He planned to give his husband and/or wife a diamond in the Sonic Riders dub.

[@screamoneo]

You can feel everyone resisting mentioning Eggman’s “Super Laser Piss” when everyone just sits silently when the ARK fires the first time. And then someone pipes up “Hey, REFERENCE!”

[@thatonesupercooltoony6192]

IT WAS ALFRAD TO HAHA

[@DapperPlague]

and then he just casually makes explosion sounds like nothing happened

[@AmedeusMkII]

I can't believe it blasts this universe's White House and not one "How do you like that, Obama? I pissed on YOU, you idiot!"

[@ballisticboo7808]

And then it all comes full circle with the Super DUPER Laser Piss

[@Dinoman972]

@@thatonesupercooltoony6192 I thought it was Mar.

[@BarrenAcc]

25:29 "What? No, I'm the devil" *"H E A V Y D O G"*

[@april3153]

“SHADOW THATS A DOG WHY ARE YOU KILLING- NO-“

[@vito6197]

EYYYY

[@constellationmaker145]

WELCOME TO THE HEAVY DOG

[@ultra1616]

@@april3153OOOOWWHH MY GAAAAD, Well that's a hundred billion dollars of the US government ye know?

[@Hellfireandfriends]

@@ultra1616that was kick ass dude!

[@Pogbirb]

Shadow canonically became the us president, made murder and furries legal, befriended satan, pissed off satan, went to heaven, went to hell, died, killed sonic, eggman and Satan's dog, removed crypto currency, destroyed the blockchain and became a streamer all in a single 1 hour video. Truly a masterpiece

[@israelmcclain8097]

Eggman was right, Shadow really is a menace to society.

[@erikfrommeyer2606]

We should’ve seen it coming when he fucked egg man’s wife

[@afanisthedolphin]

Don't forget rewriting the constitution and going to chuky cheese.

[@Databrained]

So inspiring

[@emidemi7211]

He killed Jonathan too.

[@JugularJohn]

The idea that this game resets the day like Groundhog Day for Shadow honestly makes more sense for the actual story.

[@buisnessman1237]

true

[@nullhydrangea]

Hedgehog Day

[@endergeek236]

@@nullhydrangea Boom beat you to it

[@ChrisPoindexter98]

Indeed. I imagine that helps clear up head canons and the multiple timelines issue a bit, but especially like you said for how this game usually goes with having to unlock all 10 endings from the 600 possible *named and titled* combinations of paths, just those 10 endings to get the final "zone/area."

[@porygonlover322]

i love umineko

[@RougeTheBatReal]

the line "maybe Maria wasn't all she cracked up to be" is so raw

[@darxmarx8313]

it's cooler than anything the official shadow has ever said

[@LannyLeArtist]

True

[@dluxx3719]

Never turn backs intro made that line so well

[@NinjaNezumi]

She's rite tho Furries are 2nd class citizens ALWAYS WILL BE! XD

[@jacobthurmond6210]

@@darxmarx8313 "If the world chooses to become my enemy. Then I will fight as I always have." Ryan's is good, don't get me wrong. But the official line slaps harder than it has any right to.

[@Colelyoe2]

I'm here to inform the official VA of Black Doom in Sonic x Shadow Generations know snapcube fandubs and is making references on their social.

[@tacobellabeanburrito]

What?? Where!

[@AcidSlashDX]

Really? That's huge!

[@Goobysnoobert630]

What has he said!?

[@user-kw5jl5wt9f]

SORRY???

[@yourdaddysaid]

@@Goobysnoobert630he said “HEEYYYYY WHATS UPPPP ITS MEEEE” ơn his twitteer

[@anewhero1216]

44:54 “Shadow you’re an asshole, man.” “You are what you eat, Sonic!” You know the joke’s good when everybody is briefly knocked outta character lol

[@ZachNohKap]

True

[@pocketsizedviking4555]

i just know that he was waiting to say that since the 06 dub

[@chaosinc.382]

"That was kinda sick!" "Thanks! I worked hard on it"

[@Chitose_]

ｓｕｓ

[@spookskeley]

that made me laugh to hard

[@necrodeus6811]

Shadows gradual disillusionment towards his relationship with Maria, concluding with Maria revealing that she implanted his hatred of furries into him, is the biggest character arc in the dub imo

[@Crackedcripple]

Based Maria she did nothing wrong

[@lemone630]

She made him the ultimate lifeform

[@ochuspin]

@@nighton8223 and that is relevant because?

[@funnyvideoguy3216]

And I love how he handled that realization. He just casually went “maybe Maria wasn’t all she was cracked up to be”

[@GoAway3729]

The devil slowly getting more angry and eventually breaking was really good too

[@rocco4143]

the fact that i felt moved when shadow said “maybe maria wasnt all she was cracked up to be” shows how deeply some of us follow the lore of this

[@azazelvictorique]

It was weird somehow there was actual character development in this whole thing

[@m1lfshake]

ME TOO LMAOOO

[@fontanna888]

I'm glad I wasn't the only one who got hit hard by that last sentence! I just finished watching (I know, I'm late 😭) and immediately rushed to comments to see if anyone else would be taking about it. Damn, I love snapcube. All this lore, the dubbers themselves, the whole fanbase... Love you all! 🖤♥️🖤

[@xacmashe3852]

It hits a little harder because that's basically Shadow's canonical character resolution by the end of this game, leaving Maria in the past and all that instead of basing his whole life around her. ...granted Shadow more or less still follows her wishes (protect the world) just in his own way.

[@Flump-Master]

I think her saying “remember, furries are second class citizens” and him saying “maybe Maria wasn’t all she was cracked up to be” straight after reveals that shadow was a furry all along. Maybe his endgame was to give furries more control over the world’s politics, hence him making them legal and letting them vote. I bet charmy was in on it as well, since he said he was able to vote hundreds of times, or maybe he was even pulling shadow’s strings from the beginning.

[@JackMarsk]

55:38 "You forgot the number one sin, devil! *Thou shalt not have any gods before Me."* Holy fuck, this line goes HARD

[@minecrafter3448]

I saw this described really well by someone else in this comments section I cant find. “Shadow knows 3 sins total, and two of them are adultery” This is the third sin he knows

[@youdontknowwho505]

@@minecrafter3448 Dude, it’s right below me/this comment.

[@Fictionalcharactersimp145]

I think it was dogs lmao

[@radbones3172]

“Most actions are sinful” The Devil says as almost everything Shadow Does nearly guarantees him a spot in Heaven

[@lachlanmcgowan5712]

Yeah that's because Shadow is really bad at sinning

[@queenofvermin]

​@@lachlanmcgowan5712legit the game's actual good ending

[@fredericksmith7942]

I mean shadow then proceeded to topple several evil institutions so the devil kind of had a point.

[@Rosie404]

the fact penny was taken SO aback when ryan said "you are what you eat" was SO FUNNY

[@Taterr__Tott]

Timestamp? I missed that

[@WhiteWolfRQ]

44:55

[@Taterr__Tott]

@@WhiteWolfRQ ah thanks

[@killerkittygaming4365]

LMAOOO FR

[@scarsch1286]

One of the best lines in the dub. Except very part chase was in(he voiced the Devil right? Tell me if I’m wrong pls thx).

[@NelsFofana]

33:53 i love how the music stopped as Eggman got offended by that insult and cut his own line to threatren Shadow very menacingly

[@thispurplebean2]

can't make this shit up XD

[@ryandennison8754]

Shadow found what is quite possibly Eggman’s one sorer spot than his wife: his incontinence.

[@WaverVr]

And then he violently coughs

[@ballsinspector42069]

"YOU MAY BE THE- *dontyouever FUCKING CALL ME THAT, EVER AGAIN! I'LL KILL YOU!!! hhHHHHHHHHHHHHHHH-"*

[@theultimatetempest1918]

Also happened when Eggman realized he didn't want to die yet

[@cammie5444]

46:01 THE WAY SHADOW SOUNDS SO GENUINELY ANNOYED LIKE IT WAS SO SPOT ON THAT I COULD SENSE THE ANGER THROUGH THE SCREEN *S T O P*

[@elinotnormal]

he was DONE😭😭

[@itrashcant7947]

He sounds like an angsty teen yelling at his dad 😂

[@constellationmaker145]

he's so fucking done lmao

[@NebulousSedulousStrenuous]

lol

[@yobin3711]

Chase is the fucking GOAT. Memphis Tennessee, Storm, and now the Literal Devil from the Bible all stole the show in these past 3 Sonic dubs. The fact that he plays a different character each time and yet always fucking nails it is genuinely so impressive.

[@seaturtle1181]

dont forget mikeiplier

[@infinitynull9597]

Chase always steals the show in every fandub.

[@renansantos6533]

Chase is reaching Alfred's Legendary status 😀

[@windbreaker2432]

Needs more Eggman 🗿🗿🗿

[@calvingates6185]

@@renansantos6533 honestly i think Alfred hasn’t gotten much time to shine since eggman barely appears in the last two games. Alfred was super good mostly since eggman showed up alot in 06 and the other

[@kouhaiforhire]

As a person who knows nothing about this games story, this was just so much more of a fucking ride

[@FungiGamer]

It must’ve been a hell of a ride to make, the game branches oilut into like eight or 10 multiple paths which often makes the story inconsistent

[@StarryInkArt]

same

[@just_eve745]

Same lol

[@loonloonlikemoonmoon1577]

This story actually makes more sense than the actual game story

[@detectivemememachin5011]

That makes it better

[@3n3my33]

Honestly I really admire Alfred's restraint from using the "pissing on the moon" meme for cheap laughs. He references it rarely enough that it's actually still funny when he does

[@Shadowonshadows]

The merch is tasteful as well

[@cheeseburgerowl937]

He said he was getting tired of people constantly demanding he quote it so I wasn’t even sure he was going to reference it at all.

[@jos4669]

Im glad its rarely referenced, its an incredible and iconic moment but refraining from saying it only allows for more amazing moments from alfred, which he definitely delivers. i adore his work as eggman.

[@maximumoriginality]

I agree. It helps him show off that he’s more than just the “pissing on the moon” guy.

[@fricketyfracktraintrack]

@@Shadowonshadows it's really good! I just saw it last night while checking out his Twitter out of curiosity (cuz I don't use Twitter) and honestly that bisexual eggman blanket is looking real nice 👀

[@corn_ball]

Dub's been released a year ago, but the line at 57:55 with the somber music and Shadow saying "Maybe Maria wasn't all she was cracked up to be." Chills, literal chills, despite the context of the actual scene, this feels like something canon Shadow would eventually understand and actually say to finally let go. 🧍‍♂️

[@GnuGamePlus]

This line being legitimately good only makes the line before it way funnier.

[@buttpiratesbuttpirate5913]

But furries are second class citizens. Maybe Maria isn't all she's cracked up to be, but she IS based

[@modestMismagius105]

​@@buttpiratesbuttpirate5913 people who unironically use the word "based" in 2024 are second class citizens

[@buttpiratesbuttpirate5913]

@modestmismagius105 you're first mistake was assuming I'd care what a furry had to say. Your second mistake was thinking I cared what YOU had to say

[@KingKayro87]

​@@modestMismagius105That's pretty based, man.

[@EmperorSeth]

I appreciate that this fandub demonstrated the old axiom, "The greatest trick the devil ever played was reminding literally everyone he ever meets that he exists. Like constantly. Every chance he gets."

[@halfmettlealchemist8076]

“Gaslighting’s like, my specialty. I’m the Devil. Did you know that? Hi, I’m the Devil, by the way, nice to meet you”

[@LannyLeArtist]

@@halfmettlealchemist8076 Lol

[@Healcannon]

This confused me so much at first lol. I had to relook up what the real quote was.

[@snuuzzyy]

It's even better when you think of how the Devil wanted to be noticed by Shadow b/c the Devil was a hardcore fan.

[@marcusmanslaughter]

I'm openly weeping at my kitchen table, If i die it's because of this comment.

[@drag0nerd]

33:38 "I went to go vote and I saw a person's fursona with Bowser's *FAT ASS in line,* you have some explaining. TO DO-" is one of the funniest things because it implies Eggman has a political alignment AND that furries LINED the polls the second Shadow made amendments to the Constitution

[@Montesama314]

He's a Reknucklican.

[@seachelle2316]

​@Montesama314 i hate that this made me laugh

[@ashen_roses]

That and also the Mario universe exists

[@NathanSF-qr2ds]

​@@seachelle2316 and Shadow is a democream

[@seachelle2316]

@@NathanSF-qr2ds i will never emotionally recover from this

[@ownerofayoutubeaccountnoto5322]

The fact The Devil (from the Bible) actually seemed pretty chill throughout most of this made his breakdown on the Black Comet just THAT much more memorable

[@godlovesyou546]

Yes that was epic

[@Maukiki]

i felt bad for the devil tbh

[@sirgideonofnirtheall-knowi1881]

@@Maukiki so you might say you have sympathy for him?

[@thenyan3095]

@@sirgideonofnirtheall-knowi1881 I mean who wouldn’t? shadow never responded to his twitch messages, that’s a story worth crying over smh 😔

[@cyanide167]

@@thenyan3095 kinda missed the pun mate

[@zioske]

46:00 black doom coming back 19 years later just to fuck with shadow

[@nelululuculu]

19 years? damn, sometimes i forgot this game was released in 2005 and we’re now in 2024

[@n1conicokneecaps]

Thank you for the timestamp that's my favorite line in the whole dub

[@Garagelab164]

Wouldn’t it be 6 years? Since Sonic generations and Shadow generations happens at the same time.

[@applepieexplosion4030]

"actions speak louder than words" "These hands speak louder than actions" Is legit a great line

[@EF-kk3vh]

MY FAVORITE PART

[@Sagu_Un1_]

666 like 😎

[@jinxyjangle]

Time stamp?

[@crystalevergreen6440]

@epicgirlsonic 51:38

[@christopherstrickland1363]

What do you think would happen if... Shadow the Hedgehog took place in the Pre-SGW Archie Sonic universe?

[@crimsonsonic2]

Eggman dying, saying “Here, hold the-“, dropping the bomb then dying again was easily my favourite part. For people who want a timestamp, it’s at 22:05

[@funpoke05]

My favorite part

[@giygas_9577]

My favorite part was *belch* I'm dying... 22:56

[@Soyed_Boy]

do you mean a timestamp?

[@nuggetangel103]

@@Soyed_Boy i suppose it is indeed used to skip time, so I wouldn't say they are too incorrect

[@Maukiki]

Bombs? They are yours my friend Nice morshu refrence

[@roachno.24]

51:58 Chase realizing the devil is doing telepathic shit and stumbling to explain is so underrated

[@constellationmaker145]

PSYCHIC ATTACK!!!

[@Seba12322]

Yeah I like to see it as shadow falling and the devil was “oh shit uhhhh yeah no that’s my doing”

[@nickbrown638]

I like to think, in this version, the devil just saw Shadow have a migraine or something and is just playing it off.

[@MrTrippleAAA]

I see it as the Devil is just doing it naturally to him without even realizing and shortly after he's just like "Oh wait, fuck!"

[@BatailleRapTishort]

SYKIK PPP-ATTAK

[@happytristan5511]

shadow:just existing black doom somehow returning in SONIC X SHADOW GENERATIONS: 46:01

[@scrungobeepis5443]

Can’t wait for the SxSG Fandub

[@oozingears]

Had to come back to relive the shadow game 😂

[@DaHman1112]

That is like my favorite line of dialogue ever I am going to quote that’s so much

[@derekmaullo2865]

Black Doom is a trash villain

[@thespy.official]

​@@derekmaullo2865 how dare you insult da devil from da bible

[@JaxontheOkay]

"Gaslight me! Gaslight me!" "Uh - I already am. I was gaslighting you this whole time." "Uh huh huh huh... cool!" "Shut up." i love this series so fucking much

[@cloverlucky5977]

Time stamp?

[@JaxontheOkay]

@@cloverlucky5977 44:15

[@unfractured_]

44:24 if you just wanna get right to the joke

[@skunkyemerson809]

45:21 underrated joke: Penny not knowing what to say there and just completely flubbing the line

[@Schnort]

Straight up my favorite moment in the dub

[@youdontknowwho505]

And a- what about um- uhh… *_WHEEZE_*

[@VioletIsBiru]

The woman was too stunned to speak

[@DAMIENDMILLS]

I mean, I don't blame her, they didn't give Sonic much to say. It was the same with the Devil when he wanted to break down the myth of Americana, but had no time to get into it.

[@QueenA.G.]

Honestly that fits for Sonic looks he’s trying to get involved but nobody cared 😂

[@clarissarojas7959]

Chase is sooo good at playing characters who slowly become more and more unhinged as the story progresses, it’s so good every time

[@CosyBee]

Oh my god he'd be the perfect Jack Baker if they ever did Resident Evil 7 dub

[@commissarthorne3894]

My name's Mikeplier

[@dashat3938]

yes

[@clarissarojas7959]

@@commissarthorne3894 exactly who I was thinking of

[@emblemblade9245]

Oh my god this really is the second time Chase played a guy who goes on an unhinged rant after Shadow ruins their attempted friendship

[@q-tek8349]

20:14 "From Sonic?" "Yeah, from Sonic.... Wait, from So-" I like to think that Shadow is shocked not by the fourth-wall-break, but by the fact that the franchise is named after Sonic instead of him

[@blueflare7687]

i like how in literally every sonic fandub, shadow always somehow pisses off the main villain so much they end up making a massive speech ranting about how much they hate shadow. SA2 had Eggman ranting about how Shadow pissed on his wife. 06 had Memphis Tennessee ranting about how awful of a boyfriend Shadow is and how awful his friends are. And now Satan had a massive rant about how Shadow means nothing to him and how he is the good guy in this story. Literally every story Shadow’s in, he ends up pissing off the villain, and it’s great.

[@jeamsis]

SO TRUE. One of my favorite things in this particular fandub is that Shadow is just the villain the entire time and everyone just accepts that this is the way he is

[@Moomoomaniac]

@@jeamsis you could say that they don't mind that he is all of he

[@HashiNuke]

Just call him "Devil From The Bible"

[@T_Dude]

If Shadow was in Rider’s, he’d piss off Jet by spoiling the story of the games for the GameCube 2.

[@oliverholm3973]

Well he _is_ quite the proficient pisser

[@raphniamagna2567]

35:07 i like how this implies that not only did shadow make furries legal and allow them to vote, but he specifically made it so that furries can vote as many times as they want at once AND that charmy has a political alignment

[@unusualusername8847]

Charmy is treating votes as NFTs and devaluing them by saving them as jpgs. So he's committing both massive voter fraud and ruining cryptocurrency at the same time.

[@theMyRadiowasTaken]

i personally prefer the fact that furries were illegal and not allowed to vote before

[@buttondowndingo]

Cant wait to vote ninty six times in next years election.

[@theMyRadiowasTaken]

@@buttondowndingo personally im just going to keep voting for someone new each time

[@arandomkobold8403]

​@@theMyRadiowasTakenthe great vote equalizer

[@ChaosSammy]

I can't believe Penny would sell this dub to us like it was a Shadow dub, only for us to have to find out that it was in fact a secret Heroes dub. I could not be happier to be lied to

[@gabrielgrant8913]

So a two in one deal? NOICE👍👍👍👍👍

[@SemiHypercube]

I'd be down for a full Sonic Heroes dub

[@CommanderDiamond678]

@@SemiHypercube I think they are planning on doing it but for now they are just teasing it for when they actually do it.

[@KioTheCoolDude]

@@SemiHypercube okay now I'm starting to see you everywhere. KZbin, Twitch, Discord H u h

[@cy5434]

@@SemiHypercube It would probably be like, 20 minutes long lol. Heroes has very few cutscenes.

[@smalliesxd]

45:21 penny’s stutter is so underrated im CRYING

[@scarletthecat1491]

Then her cracking herself up xD

[@noriakikakyoin5745]

10:16 I like how Penny made sure to keep Sonic and the President’s past relationship canon, implying in that same sentence that Sonic was hiding murderous thoughts when he and Tails stole the Sims 4 DVD from him back in SA2

[@itsRhodi]

Unrelated but I love her delivery of her next line 😭

[@concept5631]

From a previous dub or game?

[@noriakikakyoin5745]

@@concept5631 From a previous dub, specifically the Sonic Adventure 2 hero story dub

[@concept5631]

@@noriakikakyoin5745 Thank you

[@Door227]

Imagine someone who has never watched a fan dub before reading this comment

[@terencecobain]

I love how Shadow is just ultimately the villain in this dub, regardless of what path of cutscenes are playing.

[@IcyDiamond]

Even The Devil is a better person than him, dude just wanted a friend :(

[@sinor_be9814]

Well Eggman Blowing himself was the Funniest scene in my opinion

[@KrispyyCookie]

@@sinor_be9814 XD

[@frannielmartinez]

@@IcyDiamond Yeah, but that's the way Shadow was created. Why do you think he did all those nasty things to Eggman back then with the Wife Incident?

[@emblemblade9245]

Is he really the villain when he helps waste the US military budget though?

[@michaelbk0076]

I don't care what anyone says, Chase was the fucking GOAT of this one. Not only was did his take on Black Doom steal the show, the fact that he was able to keep his composure throughout the whole thing is a feat worthy of god itself

[@scuddbucket3300]

hands down my favorite character throughout this entire thing. the voice reminds me of the police officer from the Super Mario Logan videos 😂

[@KaiserMattTygore927]

Chase was absolutely killing it.

[@menkadem1601]

@@scuddbucket3300 yeah except chase is funny unlike sml

[@FeligamiAdrizoeSworaDooplivian]

@@menkadem1601 Super Mario Logan slander?! I love it!

[@rosePetrichor]

every time he said 'hey shadow, it's me, the devil' it killed me

[@stormroot_dragon299]

33:49 “Or else you’re under arrest, eggman, eggface, egg-poopy-poopy-butt” “You may be the- *don’t you ever fucking call me that ever again I’ll kill you* “ *ÆÛGHH* (Laughing) “Not if I kill you first” Gotta be my favorite part-

[@pridex45]

The fact they managed to take a convoluted, multi-route storyline and turn it into a parody with consistent storytelling in real time is fucking genius.

[@ILSCDF]

>consistent Idk man...

[@capootiscrepitoos]

Actually less convoluted than the original STH

[@Jaeeden]

@@ILSCDF Idk man... the sin points, becoming president, the Devil having time powers, becoming King of Hell, Eggman being King of Hell, Shadow having very little sin points, Vector wanting to right-click-save NFTs, Espio and his crypto... seems pretty. consistent to me.

[@jeremywaygay]

@@ILSCDF it was very consistent, they even kept continuity from the previous dubs

[@lucaswatson5845]

Black Doom (AKA The Devil from the Bible) absolutely stole the show here. Literally every single time they showed up was hysterical, largely in part due to the incredible voice acting, and the way their antics so seamlessly matched with the plot of the fandub was the cherry on top. Definitely my favorite performance in this fandub.

[@JuliaTDI23]

As for the voice acting, it's the same person who voiced Mephiles and Storm that were great highlights in their respective fandubs (you probably already knew that but anyway-), so it's a big YES. And I really liked the part where he goes mad lmao

[@SilverAceOfSpades]

@@JuliaTDI23 And Mikeiplier from Until Dawn!

[@IcyDiamond]

He really gave me SA2 DUB Eggman vibes

[@Wings_Of_Nightfall]

@@JuliaTDI23 I think you mean Memphis Tennessee.

[@halfmettlealchemist8076]

PSYCHIC ATTACK!

[@AliJ5533]

20:07 I love how Shadow *almost* considers the existential implications of Eggman being "from Sonic", but is saved by distraction.

[@JazzyLogical]

And thus, the fourth wall stayed...mostly intact 😂

[@Ashly-28]

@@JazzyLogicalit was left with a couple of cracks in the wall but it's mostly intact

[@gamerule18]

Ass cracks, if you so kindly will

[@Kawamagi]

he almost went to rude mountain

[@Person-lh5fp]

We don't talk about rude mountain, it's too mean

[@MostmajorofLs]

This fandub genuinely convinced me that the plot of shadow the hedgehog was Shadow was stuck in a timeloop. It was only when I actuLLY Watched a playthrough that I realized the "timeloop" was actually because there's just so many endings.

[@samdoezzzstuff]

32:08 THE PURE ANGUISH IN HIS VOICE WHEN HE'S FLYING AWAY IS SO FUCKING GOOD

[@samcarroll6210]

Probably the best acting in the whole dub

[@SagaHanson25]

I was for him to finish it with “you absolute thot!”

[@browsing_gh3]

So true

[@godzillaworks4585]

Who drew ur pfp

[@JadeWSW]

​@@godzillaworks4585me😋

[@InfoDump]

Ryan yelling "MARIA" was somehow 10x better than the one in-game Also, Chase at 46:42 is also pretty good acting what the hell

[@EdgarAllan2pointPoe]

It sounds exactly like what Shadow's voice actor would sound like if he expressed an emotion other than brooding.

[@InfoDump]

@@EdgarAllan2pointPoe E10+ edgy brooding at that

[@FormalFilmsProductions]

For sure

[@ashen_roses]

It was fantastic. Like I got nauseous just hearing it.

[@omoriqo]

FR

[@jumbojimbo41801]

I seriously don’t think enough people are appreciating 46:02, the 1 second we see all the happiness and triumph drain right out of shadow, followed by the super genuine “STOP!!!!!!”

[@nolandspring]

that STOP is so fucking good

[@L0u8823]

I know right it’s criminally underrated

[@stelvu]

HELP LMFAO

[@L0u8823]

The disappointment as he lowers his hands 💀

[@monroewolf]

i know right? love how shadow sounded like an angry teenager getting mad at his mom lmao

[@kohammy]

can we all agree that this is the most consistently funny sonic fandub yet, all the jokes landed despite being improvised and i really felt like there wasn't a single moment where i wasn't laughing

[@jimazo]

For real... even little in between moments like Penny stammering land incredibly well

[@Emmett_Br0wn]

The transition at 25:27 kills me every time- " Wait- WERE YOU MARIA!? " " What? No I'm the devil- **HEAVY DOG** "

[@preppar8872]

XD

[@soffisoffy2709]

“Hey~ welcome to the Heavy Dog!”

[@FallenRigel]

AYYYYYYY WELCOME TO HEAVY DOG

[@nathanwebb6192]

@@FallenRigel hey don't don't destroy this thing you know how much this cost like 100 million dollars

[@Cosmo_Or_Something]

@@nathanwebb6192 do you wanna know how much I cost? **69 cents baby**

[@lechugajam756]

I really have to shout out Alfred at 56:53 for interpreting Eggman's sneaking away as him just having really bad knees. Such a tiny moment that makes me laugh every time

[@kaysrandomchannel4618]

Gotta love Alfred.

[@luigiclone0286]

Chase really is popping off in these last fandubs. He has really perfected the art of making shit up as he goes

[@FlareBlitzBanana]

He really showed his talent in the Dharr Mann video, especially with his inspiring line of "iwannaplayminecraftletmeplayminecraft"

[@excisionsstepserum8336]

Which one is he, sorry my dick was in the way of my glasses and it fogged them up because it kept breathing on them

[@strelitziamystery21]

@@excisionsstepserum8336 The Devil/Black Doom

[@MSCDonkeyKong]

thats because chase was always hilarious in these. making him black doom is such a perfect choice, him and ryan have the perfect comedic chemistry in this

[@snuuzzyy]

@@MSCDonkeyKong Don't forget the legend himself, Alfred.

[@enlongjones2394]

Underrated joke: Shadow instantly KOing everyone who tries to talk to him while he’s holding most of the emeralds. They just fall on the ground mid word sometimes.

[@Klui_]

Every single "heeeeeeey" from Black Doom sent me into hysterics, absolutely fenomenal work by everyone here

[@gamertwo6263]

Don’t you mean The Actual Devil?

[@josiahtheawkward6008]

Shadow: “STOPPPP”

[@christopherfloody5555]

@@gamertwo6263 you know, from the bible?

[@jeamsis]

*phenomenal sorry not to be rude I just thought thatyou might appreciate to know :3

[@negamewtwo5535]

Welcome to the blockchain!

[@destroyerkitty9434]

44:54 Underrated moment right here. I love how utterly caught off guard Penny is by that sudden and cursed response.

[@WindyWooshes]

one of my favorite moments lmao

[@sillymanbanished]

@@WindyWooshes same bro

[@ShuichiSaihara05]

The whole cast laughing and even Ryan trying his hardest not to laugh just makes this moment priceless.

[@plainlyabrick]

he answered so fast too 😭

[@purpleflowers8723]

Lmao ikr

[@enyalim1535]

The "satan is Shadow's parasocial twitch fanboy" plotline didnt came out of nowhere, it was even hinted in 24:39 when he pretty much asked incessant questions about Shadow's personal life. Immaculate foreshadowing!

[@SheetGhostWithBones]

I think that scene specifically was the devil mocking shadow for being unable to save maria.

[@steamachest2077]

There's also this moment 30:00

[@halfmettlealchemist8076]

@@SheetGhostWithBones I think it's funnier if he doesn't know who Maria is at first, and genuinely thought that she was still alive and was just thinking, "Man, she's so lucky, I wish I could be Shadow's best friend"

[@jaidcortez5210]

bravo zase

[@GamingTopTen]

The real foreshadowing is when that GUN Soldier subscribes to the president's OnlyFans and Twitch.

[@bonedude666]

36:16 Charmy's "I can die happy tomorrow" combined with Chase's "Tomorrow?" with genuine concern is so fucking hilarious.

[@MapleLeafAce]

25:25 the deadpan delivery of "Heavy Dog" is so underrated especially since there's no need for him to even narrate that lmao

[@texivani]

There's something so good about the combination of that and the immediate jump to "EYYYYYYYY HEAVY DOG HERE"

[@bjkaye9918]

Heavy dog!

[@sanicboistolen]

It just felt like he successfully changed the subject lol

[@JoshTheWoz]

*AAAAYYYYY WELCOME TO THE HEAVY DOG*

[@luminxscent5235]

*HEAVY DOG*

[@StoneWeevil]

45:59 Shadow's exasperated _"STOP!!!"_ gets me every time

[@thatonegaybitch1811]

the first time I watched it I choked on a carrot and had to give myself the himlech maneuver with an old christmas tree box.

[@Ledragonboi27]

*HEYYYYYYYY WHATS UUUUUPPP! ITSSS MEEE!*

[@PeeceOfToast]

STOP!

[@joviko5132]

@@thatonegaybitch1811 dawg you just made me uncontrollably sneeze with that "heimlich maneuver with an old Christmas tree box"💀💀💀💀💀

[@doomus_]

@@thatonegaybitch1811 OH MY GOD YOU ALMOST DIED can you sue them for that???

[@addictedtochocolate920]

33:55 The scene transitioning from Eggman threatening Shadow to Eggman coughing his lungs out was probably the funniest for me. Alfred's coughing in general will never not be funny

[@hansraute3587]

How he transitions from saying "ill kill you" to coughing on the floor is amazing

[@HashSl1ng1ngSlasher]

His delivery of "you have some explaining TO DO" is one of my new fav eggman lines.

[@momimhome7540]

33:55

[@paper_stars_4_mental_health_yt]

50:59 dude I just realized how amazingly full circle this is bc during the first dub Ryan during every actual gameplay scene just sang pumpkin hill and it continued to be a running gag always. I loved this

[@jessbian3385]

46:30 This is genuinely Chase’s best performance, its so iconic. Its on the level of Alfreds Pissing on the Moon rant. Its so GOOD.

[@vibevizier6512]

Its VERY GOOD

[@goatcat2737]

Like of course Pissing on the Moon is much more memeable, but by god Chase fucking sent it Personally, this is honest to God one of my favorite performances in all the fandubs in terms of sheer performance and emotion The way his voice falters in anger and yearning, and the way he somehow managed to keep it comprehendable It's just fucking perfect

[@destroyerkitty9434]

I don’t care. I DO NOT CARE.

[@bionicdragon5]

Sonic: "Oh my god, he's fucking losing it! I haven't seen this since... well..." Glances at Eggman. [SA2 Fandub flashback]

[@Lakeside_Flower]

Penny was being genuine when she said “he’s losing it”

[@D3NS3TSU]

56:44 anyone realise that tails is speaking yet the voice actor still had the devils dog voice changer on? 😂

[@Okeana_Aster]

Oh I thought it was just an announcer thing, like someone off screen. I didn't realize it was Tails ^^'

[@mad_timbit]

I’m dying

[@coyotix]

my theory is that mar knew he had the filter on and just decided "nah fuck it"

[@Door227]

It’s actually forshadowing for shadow the hedgehog fan dub 2 where the spirit of the devil dog possessed tails and wants to get his revenge for the devil

[@yaboi-rowlet]

I rlly hope they continue that gag like the speedrunner Mario being possessed

[@KKwinner123]

31:53 I can't believe more people aren't talking about this delivery, it's SO good, just softly describing her death

[@stupid_little_thing]

i'm dying because i'm so ✨ *surprised* ✨

[@random_person394]

​@@stupid_little_thingI have to contain you in here😞

[@introverted_madness]

What? 😮

[@random_person394]

@@introverted_madness Your fart smells so bad...😔

[@Embodiment_of_trash]

@@random_person394wait… IT WASNT ME!

[@mushroomfusion245]

Black Doom and Mephiles not having mouths and thus not needing visual cues to know when and when not to talk really helped them become the highlights of their respective dubs.

[@carterulery]

38:20 i love moments like this where the actor just knows what is gonna happen and plans ahead of time for jokes like this

[@nostalgiagaming8955]

The Redbox Coin joke in the Sonic Riders dub

[@carterulery]

@@nostalgiagaming8955 exactly what i mean LOL

[@brazenduke8164]

“Tell it to us in excruciating detail Tails!”

[@EmileeAria413]

Penny is the one who most commonly does this since she's the one who edits the clips together so they can do the live dubbing in the first place, and every single time it's fucking gold. "Tell it to us in excruciating detail, Tails!" Is probably my favorite example, but every single instance of Penny using her knowledge of exactly what's coming up next to set up a joke fucking slays me.

[@aci6737]

@@brazenduke8164 "it was a whole dream-UH BYE"

[@lainamitclaire]

the line at 23:21 is actually extremely raw. Imagine Shadow actually telling Eggman that he's going straight to hell, and when he wakes up he'll see Shadow on hell's throne. Fucking metal as shit.

[@purpleluckxd371]

And then it was followed by “plus L plus ratio” which made it even more metal

[@redinahedge3073]

Shadow did tell him he’s going straight to hell in the original game actually.

[@fricketyfracktraintrack]

*Montero plays in the bg*

[@genericname2747]

@@redinahedge3073 wait really???

[@Schnort]

@@genericname2747 yes and it's actually the most hilarious thing ever

[@--gato]

24:20 The genuine surprise and fear in Chase's voice is just PERFECT AND SO FUNNY

[@StarkMaximum]

"That scared the shit out of me! Don't do that again."

[@--gato]

@@StarkMaximum YOU JUST TURNED YOUR HEAD AROUND LIKE 360 DEGREES LIKE AN OWL

[@rubyrider7902]

Just so you know her name is Scout now :)

[@--gato]

@@rubyrider7902 scout is trans?????

[@austinforgie1069]

He played it off well

[@MarshallWolfMiller]

Marka sayin “I can die happy tomorrow!” at 36:15 and then almost immediately realizin how it makes no sense and apologizin why dyin of laughter is actually one of the best moments of this thing 😆

[@Olisdrawingcorner]

Holly voices charmy

[@endertrot9998]

Is it weird that what I’m most hyped by is just how good Ryan is at the emotional lines???? Like, it’s going to be a fantastic comedy piece but Ryan’s take on Shadow is so *genuine* in the trailer, I can’t wait

[@alizardinyourroom1361]

Yeah that line read of "Maria!" Felt more emotional than the actual read in the game

[@pizzaandpillowforts]

he's so expressive it's AWESOME for real. hopefully people show his performance as Shadow just as much love as Alfred's Eggman because they r just so funky and talented as hell

[@Trinarinaa]

RYAN IS SO TALENTED I SWEAR

[@couchiephart4212]

32:10 was especially good

[@Zerokin]

True Fact: Shadow The Hedgehog's Character Voice Acting has been so emotional since the Japanese dub of SA2, that we knew, Shadow has a rl fangirl who is a Japanese Voice Actress, and a Pixiv artist.

[@bright0nsounds]

25:27 chase interrupting himself when the boss came up like "what? no, i'm the devil. HEAVY DOG" sent me into the fucking wall

[@Chitose_]

ＨＥＡＶＹ　ＤＯＧ

[@denyhaguilar679]

Heeey welcome to the heavy TDoog!

[@ashikjaman1940]

The boss name reads are underappreciated

[@ASOtheprO]

HEAVY DOG

[@jonathantruong7069]

@@ashikjaman1940 "I am the Egg Cracker!"

[@childmanmanreal]

I love how eggman in these just…like…doesn’t directly try to stop the sonic team. Like, trying to take over apple, or watching the Incredible Hulk. He just, gets in the way sometimes and it’s hilarious

[@genericname2747]

He is trying to live his best life, but talking animals keep beating him up

[@theMyRadiowasTaken]

​@@genericname2747just like me frfr

[@genericname2747]

@@theMyRadiowasTakenPlease don't pee on the moon

[@theMyRadiowasTaken]

@@genericname2747 no promises :)

[@genericname2747]

@@theMyRadiowasTaken nooo

[@KuperSpyronicStudios]

1:55 Ok, but the line "I've outsmarted you once again, and I didn't even have to play chess this time" being said *just before the main theme* is RAW AS FRICK.

[@b.a.g-gomez2610]

Ryan, Chase and Alfred absolutely stole the show: Ryan putting his years as the character to absolute work, Chase for his gut busting deliveries, and Alfred for fully nailing improvised comedy and delivering the same level of comedy as his SA2 performance. And Penny having some of the best one-liners.

[@sfritts10]

Gotta say I’m impressed on rewatch; there’s usually 1-2 standouts per dub but this one seems like there were several A-Game performances in this one. Worth the wait 💪

[@dextreja3088]

The one-liners: *BARK* *BARK*

[@Kiwikick238]

@@dextreja3088 also " they are pretty gay"

[@JugularJohn]

Holly was also fucking underrated “YIPPEE. I CAN DIE HAPPY TOMORROW”

[@b.a.g-gomez2610]

@@JugularJohn Oh, no, Holly was amazing too. Honestly, surprised she didn't get more scenes.

[@Noir_ODonnell]

8:00 I love how Alfred says that and everyone just bursts out laughing. It’s like everyone was having flashbacks to the legendary announcement when this scene was happening and Alfred just solidified it!

[@BathwaterNoodles]

I had flashbacks as well, it’s so funny and nostalgic for me

[@Nate2010]

pissing from the moon this time

[@samboi123]

I figured he was implying Death Star

[@Goobert1]

NOW he's pissing on the Earth.

[@dontpreorder2783]

5:52 for those who missed it, drywall contains calcium sulfate dihydrate which when repeatedly exposed can cause irritation and damage to soft tissue, so when Mr.President says “I’ve been seeing vermilion red” it’s because his eyes are likely bloodshot beyond repair due to drywall exposure

[@LittleScaredyBoy]

thank you

[@Aceatoll]

Damn they should’ve covered that on the drywall podcast

[@ainsleyharriot6060]

NERD

[@freemank8207]

Thanks for the explanation

[@phoenixstupid8930]

Sinence

[@ginncide]

the absolute best part of this is ryan's complete refusal to acknowledge the bit about shadow being a twitch streamer

[@ginncide]

i mean they did establish that the president is a twitch streamer early on so its implied but you know

[@user-ll8sm2nd6l]

I like how Black Doom isn't even a real threat here. He's just an inconvenience that Shadow can't get rid of, and I think that's hilarious. Him showing up like he's at the family grill-out gets me everytime.

[@jimmyrustles9807]

Black who? All I see is the literal devil.

[@JeeJ0LeeL]

@@jimmyrustles9807 (from the Bible)

[@plantgang8738]

The fact that him and the black aliens have zero connections due to the beginning where he is surprised by them is also hilarious

[@henryapplebottom7231]

Who in the heck is black doom?

[@JeeJ0LeeL]

@@henryapplebottom7231 the Devil (From the Bible) in the original game He has an alien army and gave his DNA to help Prof. Gerald create Shadow

[@felps_4500]

4:47 "most actions are sinful" *proceeds to say 99% of Shadow's actions weren't considered sinning*

[@kaylaHat]

To be fair why would anyone assume killing the president isn't the ultimate good?

[@FMB_Player]

Yeah, is just that shadow is really bad at it.

[@michaeldaniels642]

It's possible Shadow can't sin. OMG, is Shadow actually Jesus!?

[@skibot9974]

@@michaeldaniels642 he was called Hedgehog Jesus in the SA2 dub

[@Avelonious]

@@skibot9974 Oh yeah It’s all coming together

[@willsith9762]

46:31 When the Devil goes off, he goes OFF. This whole speech was full of the purest rage, 10/10 performance

[@stnfwds]

Imagine being emotionally manipulated so hard by a hedgehog, you teleport a meteorite and crash it onto earth just to prove that he ‘means NOTHING to you’ then immediately contradict yourself by telling him you hate him so much. Implying no, he means so much to you that you’ve practically been gaslit into having a villainous breakdown of a tantrum just to show to him you can DO things of this magnitude. I love this monologue so much, it’s like Eggman’s ‘thrrrrot’ speech from the SA2 dub but hiked up ten times

[@red5158077]

Oh my God he's fucking losing it entirely!

[@noahmaldonado5461]

The only speech better is you know what

[@-sparky]

@@red5158077i haven’t seen this since, well..

[@destroyerkitty9434]

It passes as a legitimately effective villain monologue.

[@haydenbush8518]

I think that we can all agree that chase as -black doom- the devil is just as legendary as Alfred as Eggman

[@Venusbabyytoro]

48:41 will never fail to be my favourite moment

[@-sparky]

it’s so underrated omg

[@six_buck_dlc]

jesus christ Parasociaaalll!!! Youneedtolog offff!!! the animation makes it even better

[@bjkaye9918]

Jesus Christ! Why would my dad do that?

[@ethanotoroculus1060]

@@bjkaye9918 I think the most incredible thing about that line is actually the hindsight that the entire thing was a setup for the Devil to get ker'pranked so Eggman's confusion in this situation at his dad acting out of character is entirely correctly placed--

[@bjkaye9918]

@@ethanotoroculus1060 yeah

[@JMotion]

51:58 is the most underrated shit in this whole dub. You can tell Chase had no idea Shadow was gonna collapse, and he had to switch gears immediately to come up with something to explain it.

[@ЭшлиОзвучивает]

Yesss! It's so pure and genuine in the end and works so well

[@TheHedgememe]

for real, this is so damn funny and it just felt so natural

[@TreeBranchStudios]

Quick thinking too

[@INeverWanted2010]

... Psychic... ATTACK!

[@genericname2747]

It's like -Black-Doom- Actual Satan decided to catch Shadow off guard

[@drag0nerd]

19:42 Chase's delivery of "bing bong hey what's up you're doin' a bad job" sent me into cardiac arrest

[@LittleScaredyBoy]

Oh god, I hope you’re okay

[@IsaiahStickman]

@@LittleScaredyBoy it’s a joke

[@LittleScaredyBoy]

@@IsaiahStickman yes. Did you also know that wood is hard?

[@oliverspiderweb]

“I *KNOW* I’m doing a bad job”

[@TreeBranchStudios]

It sounded like a mobster!

[@theguffbin]

22:56 I don't know why but Shadow's casual "ohp- Imsorry?" just sends me

[@user-ob6cm4ui6f]

The line "My sin is lying, to the devil" is so unironically raw.

[@bumblebeeproductions1673]

Timestamp?

[@AllyAxolotlsCommentAccounthehe]

@@bumblebeeproductions1673 1:48

[@ValRabbit]

A real TF2 Medic moment. Atop the other mountain of sins he's committed.

[@Sir_Bucket]

"Fuck you, you're going to space!" is a close second

[@kattp5155]

i LOVE how penny’s only line in the trailer is her gasping for breath

[@LannyLeArtist]

💀

[@nikkie5496]

i thought she was barking 😭

[@camwoodstock]

@@nikkie5496 - Well, you were right.

[@gravelsalt7954]

44:54 The delivery on this is actually priceless, I've rewound it at least 10 times

[@zachsmith3]

i love the "thanks i worked hard on it"

[@snowy2747]

Penny nearly breaking character is my favorite thing

[@rachel_ray8997]

He does play in the dark.

[@fishyy311]

He was absolutely waiting for someone to set him up lol

[@SpringyGirl69]

I’m gonna use that “you are what you eat” from now on that’s genius

[@pennyhaywood3085]

10:37 I absolutely adore this sequence, and realizing Shadow is just chanting "GUN" for every shot he makes makes me die laughing

[@sylinmino]

Even though I think Chase is easily MVP of the dub overall, Alfred's gambling craze at 22:33 is probably my favorite moment in the dub lmao

[@littlegamerguy4803]

I’m gonna roll big numbers baby I’m playin at the poker table *I JUST LOST 300000 DOLLARS*

[@e3ch044]

@@littlegamerguy4803 but it's ok because I won 700

[@Davidpoland2005]

@@e3ch044 please dont form a gambling addiction, dont be like me

[@sylinmino]

Thanks for completing the chain, y'all

[@lixbox69]

Well Alfred's the MVP of real life so we had to give chase something

[@kawaii.universe2003]

Shadow’s “STOP!” at 46:07 was so great, you can really hear the frustration in his voice

[@tylereatongamer6651]

Shadow's reaction was like a Teenager pissed off by his dad because he was being silly

[@JoshTheWoz]

​@@tylereatongamer6651relatable to me specifically

[@tylereatongamer6651]

@@JoshTheWoz Holy hell, I made that comment 1 year ago...I'm growing old...

[@GeeGe.]

@@tylereatongamer6651 Well look who's actually made that comment 2 years ago, you old dingus

[@tylereatongamer6651]

@@GeeGe. And look who's the one that made a comment on a 2 year old video. Uno reverse! (No hate)

[@garpogods8323]

26:38 "I'm getting carried away, there's a lot of sin in this world, Sh... wh.. Is that an alien?!" My favorite part of this is that it insinuates that the Black Arms attacking and the Devil coming up to Shadow were COMPLETELY unrelated incidents.

[@emptywiz]

this part is so good LMAO

[@msp654]

7:24 someone posted a screenshot of this moment in regards to trump getting shot at and i thought "oh I should rewatch the video" so here I am

[@wisdomaxolotl2766]

This puts almost every 3rd act breakdown to shame. The depserate switch from "YOU'RE NOTHING TO ME" to "I HATE YOU" has sooo much emotion behind it. Hes a genuinly well written character and hes impoved. Its amazing.

[@Vivigreeny25]

God Chase is SUCH a good voice actor I genuinely feel for the Devil in so many of these scenes

[@my-name-is-welcome]

and then "THIS IS MY BIG FUCKING *THING* "

[@mepd3350]

​@@my-name-is-welcome "YOU ARE NOTHING NOTHING I CAN DO THIS SHIT YOU ARE NOTHING TO ME"

[@lindseylindsey9200]

I like your pfp it’s a beautiful little creature

[@buttpiratesbuttpirate5913]

​@@mepd3350"I'm the good guy! I AM THE GOO GUY IN THIS SCENARIO! God gets to sit up there with all his charity donating friends; i get to poke all the bad people with hit s-STICKS!"

[@eNCy.]

Fun fact: Shadow tired to make the "you are what you eat" joke all the way back in the sonic 06 fandub, but he was cut of my Memphis Tennessee before he could finish it.

[@netziguess3507]

WHEN

[@umamiusagi]

@@netziguess3507at 1:03:50!!! :D

[@netziguess3507]

@@umamiusagi OMG THANK U SO MCUHHH

[@TanyaSapienVintage]

I came here from an animatic I watched while drunk that linked the source in the description. I am now sober and it's still hilarious.

[@localestfruitbat]

48:06 “THE DUST ??” *”THE DUST !!”* underrated bit

[@JDLSTEVE75]

It's definitely underrated. It's one of my favorite parts

[@snatchles8447]

wait i don’t get it😭

[@thecondescendinggoomba5552]

​@@snatchles8447 THE DUST

[@arandomkobold8403]

​@@thecondescendinggoomba5552 The _dust_ or the *dust* ?

[@Garagelab164]

37:32 Like Eggman said the other half that disappeared.