Whole Chicken || Instant Pot vs. Cosori

[@marissashelley2362]

Cosori FYI Tip... Just in case you haven't discovered it yet, you can do the Saute/Brown as recommended here by pressing the adjust button to get to 302 degrees. I discovered quite by accident that you can get to 320 degrees if you press the Saute/Brown button followed by pressing the Pressure/Temp button (next to Adjust) immediately followed by the + button (next to Pressure/Temp) to increase up to 320 degrees. You have the same option with the warm function. After cooking has finished & it auto goes to warm, press the cancel button. Then press the Warm button followed by Pressure/Temp button immediately followed by the + button. I live alone & back during Winter when the ground was covered in snow, I'd make a pot of Soup/Stew. The default Warm wasn't warm enough; but after discovering that I could increase the temp, I'd up it so my soup stayed warmer/hot for most of the day & I more or less grazed my soup off & on all day. Found it a good way to stay warm & safer than having to go outside. I've found this useful with several of my recipes but not so important in others. Just sharing!!!

[@janefarrer2868]

I made this into a complete meal by adding baby potatoes, carrots and celery,onion on the bottom of the cooker and to the sides around the chicken. I added 1 1/2 cups water. The chicken and the veggies did release tons of tasty juices-yummy broth. I used Cosori cooker.

[@blondebailey9575]

I cook my whole chicken exactly the same way except with broth and no celery. Oh, and in my Crockpot instead. It's a wonderfully tasty dinner! And extremely juicy in the slow cooker! I'm planning to buy the Instapot and look forward to trying it with the pressure cooker method instead when I don't have the time to do it the other way. Yum! P.S. sometimes I also add green beans in the pot. P.S.S. I love the puppy avatar!

[@valerieking797]

Positive comments only...this is to show people who want to cook this way because we are in a van or small rv or are a senior like myself unable to just hop to a major grocery store...this provides the information we are looking for....if this isn’t your “thing” that’s fine, but no need to be negative, she put a lot of work into giving us the answers WE want. Thanks for the great video

[@eliz964]

@Lloyd Bonafide Why do you have to be like that? If you don't want to cook a chicken via pressure cooker, then why are you even on this video?

[@romuloromero2268]

Well said

[@kia4020]

Valerie King no 1 could’ve expressed that better!!!!!

[@blondebailey9575]

Great point! My husband and I spend a great deal of time in our rv and being able to cook a nice meal in just one pot is quite handy. It's also a great method for cooking when it's 118 degrees outside! Who wants to have added heat in the kitchen? I haven't bought an InstaPot yet (I only recently discovered this here on KZbin) but certainly plan to. In the meantime I'm watching numerous videos on what to cook. 👍I like how this will also replace my Crockpot and give me a pressure cooker, saute pan, bake pan, etc.. I'm so looking forward to buying this! As for negative comments I never understand the need of others to bother. I prefer to live by the old adage "If you have nothing nice to say then say nothing at all". It's good for the soul.

[@zaphnathpaaneah3108]

Haters keep scrolling shoo be gone!

[@susancabnet1353]

The instant pot is great if you have a small kitchen with no ventilation. Doesn't get hot in there, has the heat contained. The only thing different I would add is while the chicken is out of the pot after browning, add your spices then before putting back into the instant pot. Beef stew is done in minutes and tender, even cheesecake is perfect. Sweet potatoes or whole potatoes take minutes. Cook up as many as will fit in pot and have cooked potatoes on the ready for the week.

[@imagitext1342]

Thank you so much for this video! I just got an instant pot and after reading the instructions, got the impression all meat had to be cooked like a stew. This looks so much better! You've opened my eyes

[@sacp2273]

I do this whole chicken but instead of a trivet I halve medium potatoes and place them cut side down, or I use roughly chopped carrots celery and sweet onion. When done they can be tossed or actually eaten. I prefer to mash the tatoes with some lemmon pepper and butter, and puree the very well cooked vegies and broth in to a chicken gravy. When cooling the whole chicken I cook them breast down. This actually increases the jiuces in the breast and they never come out dry. (I learned this from my Grams for Thanksgiving Turkeys)

[@gramgramme8310]

Stewart Perthou carefully loosen the skin on the breast before you cook it and put your seasonings Under the Skin right on the beat that increases the flavor to the chicken

[@SpiritBear12]

My sister one Thanksgiving was feeling a little rushed and she accidentally put the turkey in the roaster breast side down. No one noticed until it was done. She felt embarrassed, but after we flipped it over to carve it we found that the breast meat came out nicer than it does when you cook it right side up! I'm not much for the white meat myself because it's usually dryer than the car meat. I also think it has less flavor. But this time it was pretty darn good!

[@MusicforMe123]

That is a fantastic idea, thanks for sharing.

[@darcywliu3108]

i

[@msoda8516]

Stewart Perthou That’s how my granny thought me

[@peterwilliams2557]

If you don't want to use a trivet (like me) I just throw in some potatoes or carrots and the chook sits on them. Then you have some veges cooked in the broth/juice at the end as well :-)

[@grannygoes7882]

To those who say you don't need an Instant Pot, I thought the same thing. I received one as a gift. I love it!!!!!! Especially for meat and bone broth. Doesn't matter what kind of mean, unless you are grilling for that grill taste, Instant Pot it!!

[@trazyntheinfinite9895]

You can use saute mode to brown a nice slab of meat....

[@romuloromero2268]

So many haters here! Thanks for the nice videos. People don't seem to get that if you're a busy person, you don't really have time to really bake a chicken properly (internal temperature). This is a nice technique because you literally can set it on the insta pot and run to the store, or go play outside with your kids, you don't need to run back and take the chicken out of the oven. I like to submerge mine in liquid, so then I get poached chicken that I can use for many many things (tacos, nachos, etc) and on top of that I get yummy stock. thanks again!

[@janetbrowning9089]

It's about $69, on Amazon, for the Instant Pot 6 qt and about $80, on Amazon,for the Cosori 6 qt. I'm glad I got the Instant Pot now. It looks really good...I usually bake mine in an older covered pan in the oven...I like it falling apart...just me...but, I could increase the time with my Instant Pot to achieve the same results. Thanks for the comparison too!! Great job!

[@Cocomiche]

I got a Cosori as a gift from my mom and later found out about instant pots, even though they seem to be more popular. I always wondered what the big difference was, so thanks for doing this video!

[@nancygraceh5232]

TIP: Today I put leftover cornbread (from a couple days ago) that was dried out, into the Instant Pot in a steamer basket with 1 cup of water in the bottom of the vessel, and put on manual setting for zero minutes, and did a Q.R. The cornbread came out hot and moist just as if I had baked it fresh in the oven. I'm going to try this in future with bread, cake, etc.

[@baddestjoanna-michellesmit5578]

Intresting but I can concur

[@atragedy6223]

I've used instant pot for a while now and I will say it is a great device, however, I am also saying that for best cooking, depending on what is being cooked, the oven can still offer great traditional cooking. there are times when you may want to use both, Instant pot for the majority, oven to crisp the skin, if you enjoy crisp skin,. But over all, I am using the Instant pot for most of what I used the oven for. Admittedly, using the oven can be a better option when cooking larger portions which the IP cannot handle. any method of cooking is a good method as long as you cooking fresh and get away from all that fast food garbage out there.

[@robotnik77]

That was a GREAT video, Indigo Nili, because my wife just ordered the Instapot, and I had asked her if I could cook a whole chicken with it. All the other info I read didn't say. Thank you so much. I had been buying roast chicken at the supermarket, but it's quite a bit more expensive than cooking your own, plus you don't know how long it's been sitting under a heat lamp. The market did tell me, however, that they put the cooked chickens under the lamp at about 10 AM. If you buy it at 4 PM, that chicken's been under the lamp for 6 hours.

[@johnellis4129]

If you don't have a trivet you can use celery stalks and sliced onion to keep the chicken off of the bottom

[@MsBettyRubble]

Great tip! Thanks for that.

[@yootoob4516]

Restaurants frequently use parts of vegetables that are thrown away -- onion and garlic skins, kale stalks, carrot tops, celery ends and butt. When prepping veggies, throw the trim into a plastic bag in the freezer -- it'll flavor the stock, too!

[@goofsaddggkle7351]

I’ve got a 3yr old Cosori. Works just fine - at this point would probably go IP just because there are so many people who own it so a larger community to share cooking tips with. They would work fine on both but it saves you having to do any translation of terms/settings.

[@brainjammers]

Interesting video, thanks. A lot of contention in comments about the cooking temperature. I've used an Instant Pot for a couple of years for various things, and the recommended cooking times have always been too long to retain texture and flavour. The minimum safe temperature for chicken cooking is 65C (150F), and I reckon that you'd reach that temperature after about 15 minutes for a chicken of the size shown. You may wish it cooked a bit longer, or browned in the oven - and to retain the shape of the chicken browning it at the end in a very hot oven is a good way to go rather than at the start. Today I have cooked some beef cheek for a casserole in this pressure cooker. After 14 minutes this very tough cut is transformed into a delight, but with some texture rather than just sogginess. I have to say that before I purchased an electric pressure cooker I regarded the whole thing with great suspicion, but I am a bit of a convert.

[@donald627]

THANK YOU! You have gained a new follower. Just bought a 6qt Instapot yesterday. I was reluctant to use it because it seemed overwhelming, but your videos make it supper simple and easy to follow. Now I feel like I can get my food prep started for my workouts and work week. I plan to follow your tips and recipe ideas. Keep up the great work and thanks again! 🙌🏾✨

[@maggie2sticks717]

I got a Cosori for my birthday. I told my husband i wanted an Instand Pot, he didn't know it was a brand! But that's ok, I love it. I didn't know you could raise the temperature on the saute' function!

[@lovingitonketo]

I love using the pressure cooker, like I said yesterday, it keeps from heating up my house here in the desert. I live in Arizona if you're wondering. My fav thing to cook in it is my soups. I Love a good soup and make quite a few in the wintertime.

[@hoangvienvan3689]

This is my new favorite kitchen tool! Day 1 I was going to pressure cook a meat kzbin.infoUgkxG-7WiT7ocumjytOpHDFt632PL0pxXRAg and potato stew, decided I wouldn't eat it that night so I went with a slow cook so I could go to bed and put it away in the morning. I love that versatility! The sauté feature works great and adds tons of extra flavor to dishes, and I can easily sizzle meats in the bottom then deglaze for some restaurant worthy flavors.Big bonus - you can cook a whole frozen chicken in about 2 hours. Amazing! I've seen a couple videos, haven't tried it yet, but I will soon!

[@markymark7619]

Finally! Cooking instant pot without using oven, browsing before cooking is great. So many of these use oven after cooking. I don’t have an oven in my RV this was so helpful.

[@shantrellyasharahla5528]

Hello! What size pots are those? I was wondering your opinion on 8qt do you think it would be better or not so much?

[@IndigoNili]

The 8qt is great for cooking for a lot of people or big batch cooking! As long as you have the space it's a great option!

[@IowaKim]

I think it's annoying how some people are commenting that they like oven cooked chicken better you're missing the point. I was searching for someone who cooked a whole chicken in an IP so I can cook in my RV which doesn't have an oven. For those of you who think that this is a inferior way of cooking, I'm waiting for your video on how you do it.

[@RedfishInc]

Rotisserie baby!!!! But if this is all you have it's better than nothing.

[@robertspivey46]

Kim, I to live in the a rev. But I do have an oven but I don’t use it at all. Nuwave oven is what I use.

[@ham3749]

I got an Instant pot as a gift and i look for videos on how to use it. Im still getting used to it and am not using it as much as i would like to!

[@bradleyr34]

H&AM, I just got one as gift too. I have been using a 40 year old pressure cooker. It’s being retired with full honors. The equally old Original Crock Pot is next!

[@ham3749]

@@bradleyr34 I do like the IP, I just need to take the time to learn it lol. I love my crockpot though too! The only way I will cook a spiral ham is in my crock pot!

[@laurab1089]

I was so happy with my 8qt IP that I bought a 6qt IP.. I am just in love with both of them!

[@willybilly99]

but can you cook?

[@yootoob4516]

I haven't done my research yet, but can the IP also function as a slow cooker?

[@zamfully]

I found this video informative, to the point, no wasted words, a pleasure to watch.

[@behappy2435]

Great to see how versatile the Instant Pot is!

[@esoteric6178]

I'll continue to support instant pot. I watched a story about the guy who started the company, who was also the original engineer. It really was an inspirational story. The other people have just copied his idea.

[@lindasegraves6207]

Not True. I have been cooking with digital pressure cooker since early 1990's. Instant pot wasn't on the market then. I also have used a stovetop pressure cooker since 1971. I am not saying the IP isn't a great pot just not the first and was copied.

[@seasonedsofisticate1901]

Pressure cookers have been around for YEARS way before Instant Pot. This guy just came up with a name that seemed to hav3 caught on and some fairly good marketing.

[@seasonedsofisticate1901]

Linda Segraves exactly!

[@Pattys1967]

@@lindasegraves6207 i gree,my hubby heard me mention that i really wanted an instant pot,so what does he do? he goes out and buys me a bella 8 quart 10 in 1 pressure cooker/slow cooker and i was like,what the hell is this? to myself lol but anyways,i knew he was just trying to make me happy and so,i cooked my first ever dinner in my bella,it was a pot roast,and let me tell you,it was the best ,yummiest pot roast we have ever had,so from there and almost every day,i used my bella,yesterday my son bought me an instant pot duo nova 8 quart,i noticed on it that im gonna have to learn all over again how to use it lol my bella has a non stick pan,never got a burn notice,long story short,it doesnt have to be instant pot brand to get a good result,i know i love my bella and its cheaper,just thought id say this lol hope you didnt mind,you are totally right

[@HotSixty]

Linda Segraves Totally agree. I’m 66yrs. Remember my mom had one in the seventies

[@atragedy6223]

One other spice I would suggest is Rosemary. other than that, you got the right idea for simple to apply great flavours. put the broth into an ice cube tray and voila, instant stock cubes for future recipes. yum yum.

[@dostagirl9551]

Nice comparison. I have The Instapot and love it. Even more so now as I see it’s a bit easier to use in terms of steps.

[@barbaragoodale8208]

I have a 6qt. instant pot and a 8qt cosori, and I love them both. Glad you did this video.

[@martinitime3537]

I can almost smell that chicken! Thanks for the comprehensive video. I have an organic chicken which will go into the instant pot tomorrow!

[@redcollins6597]

Use any old crock pot put a stick of butter in cavity season your chicken place in crock pot no liquid cook on low till it browns and falls off bone just like roteserrie

[@blondebailey9575]

I've been cooking whole chickens in the crockpot for years. I cook it on low (with veggies & a small amount of broth) for approximately 10-12 hours. The chicken is so juicy, it literally squirts juice out when pierced. The bones fall apart, the meat slides off if them, so tender. It makes a wonderful dinner! I'd still like a pressure cooker for when I need to cook a quick meal.

[@Littles813]

Got an IP for Christmas and this video def made me more inclined to make a whole chicken. Ignore the useless commenters! Some people enjoy making their own food. Hubs and I cook together, as we feel it adds another closeness and just hopping into the car to simply buy a cooked chicken doesnt cut it.

[@user-vf8pw3om2w]

My instant pot arrives tomorrow. After watching this video I just can't wait! Thank you for making this video it was very informative & makes me feel really excited about cooking flavorful chicken quickly!

[@tovahdambrosio9671]

Great tip on using canning lids as a trivet!

[@blondebailey9575]

I thought so too!

[@ideacrafter]

Here is a great hack that makes owning ANY pressure cooker worth it. This a weekend day project but really work it. After Indigo is finished with both chickens she need to place ALL the bones (no skin) back into either pressure cooker. I own an Instant Pot but it really doesn't matter. Fill pot half way with water and turn on for 90 minutes. After cool down or steam release stir well and add 4 to 5 bay leaves, one onion quartered and 4 cloves of garlic. Go another 90 minutes and again cool down or steam release. Take a large spoon and keep pull bones up the top of water cutting with a pair of scissors. Bones will cut super easy. Do this until bones are all about 1/2" long. NOW, fill pot to the "full" line with water and go for one more 90 minute session and after cool down strain into a large pot. Clean the Instant pot pot and re-strain (smaller) back into pot. Let cool down for several hours and refrigerate until completely cooled. (I wait till next day) Place pot on counter and skim all the fat that has separated. Place numerous opened "snack" bags on counter and using a 1 cup measuring cup fill each bag. Lay all bags flat in freezer. THIS is the BEST bone broth you've ever had and I use them for just about anything calling for water. Usually, we go to Sam's and get 2 rotisserie chickens, de-bone them, and do this.(We also put the de-boned chicken into snack bags 1 cup each and freeze) There is a a LOT of ways to quickly cook 1 cup of chicken and 1 cup of broth when you get home from work at night! Enjoy all!

[@yootoob4516]

Thank you for the side-by-side. This was very helpful. Aesthetically, I like the look of the Cosori better. For me, the Cosori provided better display feedback with the temperature reading and the progress circle as it came up to pressure. I like dark meat and cook thighs or leg quarters -- usually in the oven. This looks like a much more tender and less messy method, as well as saving energy -- oven method takes 45 minutes.

[@waynehasch5978]

I use plain Dutch oven on stove top.Well season chicken. Put on lid Cook on low.Cooks in its own juices. Rotate pieces once or twice. done in 90 minutes. Tender juicy.

[@MichelleReneDorsey]

I just ordered my instant pot in red today,I can’t wait until my Come next week,I read so many great reviews on this pot

[@kmorger]

Thank you for an amazingly concise and informative video, I really appreciated how complete it was. Minutes per pound rule of thumb, hint on saving left over liquids, and showing both units side by side to see their similarities and differences really helped me understand my own machine a bit more. Again, thank you!

[@DCFunBud]

I would use chicken stock not water. Put onions, carrots, celery, and garlic in the bottom. I would not brown the bird. After cooking I would dry they outside of the bird, brush the outside with butter, and then roast it for a couple of minutes.

[@plastamasta5096]

Guess youre a pro. All hail the chicken god

[@DCFunBud]

@@plastamasta5096 Low self image?

[@plastamasta5096]

@@DCFunBud no you have a high 'self image' stop preaching your shit on someone elses channel. Type is cheap chicken god

[@plastamasta5096]

@RainWanderswhat the cluck

[@lemonarizonatea]

Thanks for this. As someone new to cooking and also new to using an instant pot, this was helpful. It takes the intimidation out of cooking a whole chicken.

[@DougHNuts-ee3vn]

So thorough you could have earned a PhD on this presentation. Thanks for your time and quality content!

[@kirsten4896]

Bad news is I blew through 3 Cosori 8qt from Amazon in 2 months due to electronic failures. Good news is each time Amazon refunded them and I threw out the units, I kept the stainless liners. They fit my instant pot brand cooker. I'll not own a competing brand again, as my original second hand 6qt IP from 6 years ago is still going strong.

[@donc9751]

i just discovered your video because I had bought an Instapot recently and was looking at recipies of things I could cook for dinner for my wife and I. The chicken looks wonderful and we both liked the look of the Instantpot chicken best. So I looked to see if you had the ingredients you used for your spices , which you did, thank you! And we discovered we are practically neighbors!!! Small world! Happy Valley here. Thanks for posting your video's! I am by NO means or dreams a good cook, but since I was able to retire before my wife, who is still working, I thought the least I could do is try to have something good ready for her when she gets home as she is working long days and is hungry when she gets home! I stumbled on the instantpot at Costco, interesting story as I was not there to buy one, but having recently visited my sister and family in Prineville OR they were all saying how much they LOVED the Instantpot, so a woman checking out in front of me had only 1 item, the instantpot, so I asked her is it really that good and she was saying OHHH YES and today it is on sale for the last day at costco for only $75 dollars, so I couldn't leave without one. LOL Just read Lloyd Bonafide's recipe for chicken, how funny because that has been my recipe for years now! We'll see how it goes with me cooking things wish me luck!

[@IndigoNili]

Hey neighbor! We love going to Happy Valley! I hope you enjoy your new instant pot. How wonderful that your able to cook nice meals for your wife. I love that!

[@matthewronsson]

For apx. $16.00 less you could have had an 8-1 cooker instead of a $75.00 Instant Pot 7-1. YOu should have left without one.

[@donc9751]

@@matthewronsson Its perfect for me actually, no matter what the other could do. The other may be better, but I never buy cooking things and only this because my sisters loved it and and that's all the info I had to go on, so that's good enough for me. If I hadnt bought this I'd of never bought anything so I'm totally content with what I bought. Others that know more about cooking and cook more than I do, such as you for example, it may not have been the best choice, I'm not experienced enough to know, and never will be. Everything I've cooked so far has come out perfect so I'm a happy camper. Thanks for the info though maybe it will help someone make a better decision for themselves.

[@matthewronsson]

@@donc9751 The other one the same thing, plus one, but whatever works for you is best.

[@katioconnor5295]

Instant Pot, has been my large scale protein cooking source for 2 yrs and I have yet to cook a whole chicken in one... will be doing so this weekend... thanks for the detailed video!! I expected to see the chickens fall apart like slowcooker does... the amount of added liquid and trivet are crucial, pleasantly surprised they stayed intact!! 😊😊

[@moxycat314]

I got an Instant Pot for Christmas. Love it.

[@donnaa2180]

Thank you for doing this video. I just purchased mine this morning and am looking forward to learning all the options I can use to cook meals. I am so excited!

[@drswanlake]

I’ve ordered Instant pot, can’t wait until I get it👍🏻

[@anitabellefeuille7362]

If you are getting a pressure cooker to use as an all in one appliance. You should also consider getting an air fryer lid that fits it. You can crisp up the skin on the chicken with the air fryer lid after pressure cooking it. (I would pour off the juices first). Not to mention you can cook up any air fryer recipes too. I love my instant pot, I never had such easy to peel hard cooked eggs, or able to cook foods from frozen in less time than it took to thaw them before.

[@ellybear81]

I love making chicken gravy with the drippings. I just use corn starch to thicken

[@YvetteArby]

Thanks for this tip! I love gravy with my chicken! ✌🏼💖😺

[@Laurie-r6q]

Newbie here. So thankful I found your channel. Very inspirational to me to start some cooking in the kitchen. Thank you, Jesus.

[@JenSpice]

My kids got me an instapot for Christmas so I'm learning some great things here. Thanks so much! :)Jen

[@semco72057]

The chickens look great when cooked in both of those pots and I have yet to use it. I took it out of it's box, but have not put it to use yet since I have not been doing any major cooking where the cooker would be better at doing it in. I love how you did the tests and showed impartiality in doing so. After viewing the results of one pressure cooker by this one lady and she showed how the non-stick coating inside that cooker and I would not want that cooker since it has a defect in the material used. I have had skillets which did the same thing and I won't buy another one due to that defect.

[@Lovely-zy2sl]

Good job! Video very well done👍🏾 It’s rare for me to hang out on a vid for a whole 11 minutes 😋

[@susancarrier4681]

I have never done a chicken in the instant pot, but now that I see how easy it is, I am wondering why not! Thanks for this helpful video.

[@diamondeagle1522]

I think the Casori's looks better browned by its sautee feature than the instant pot. Good job!

[@juliaset751]

I have been pressure cooking since the mid 70’s. For some things, like beans, there is no real substitute. I now have an Instant Pot and it does make things easier, but if cash is tight the Presto on-stove pressure cooker is a gem at about half the price; get the stainless steel one, aluminum is bad for you.

[@soldierforchrist631]

As someone who owns a stove top Presto, an 8 qt one, I recommend going with an Instant Pot or other electric pressure cooker. Having to watch over it on the stove is tedious, and over the time that I have owned it (over three years now), about a quarter of the time I'm cooking, I am having to check up on it. New, the Presto was about $100 CAD, while a new Instant Pot (Lux) is about $130. The stove top ones last longer, much longer, but for convenience's sake, I would get the Instant Pot or other brand. And that's what I will be doing come Black Friday in November.

[@virginiaorru6848]

Just learning to use an electric pot. Thank you for all of your info.

[@lucilleball5970]

EXCELLENT REVIEW AND VIDEO AND RECIPE!!!! Thank you so much for showing in depth the two pressure cookers cooking a whole chicken, brilliant. I have the Instant Pot 6 quart and I have only done one chicken so far and it was ok good. But your browning and seasoning sound wonderful. I find you so amazing and can't help but wonder how you manage all of this with your wonderful children. Guess you are a true wonder woman. Thanks so much Nili, loved it and can't wait to cook me a whole chicken now. Many hugs to you. Claudia

[@semones57]

Thanks for sharing...Wow amazing knife skills on cutting those chickens apart...ignore idiots making negative comments, I like to see them making a video this good. 👍👍

[@neville3151]

My Ronco rotisserie oven kicks butt on both of those pots.

[@alexluvsfrogs]

Great informative video! Thanks for sharing (: For all you old dogs that don't wanna learn new tricks, no need to post your comments turning your nose up to her ways or the product, Lol...these videos are for people who wanna learn newer ways with newer products. Why the need to post comments about an oven and old school ways, I'm sure she is fully aware of all of that, anyhow. That is not the point...rolls eyes*** some comments are so irrelevant and unnecessary! Just makes one look silly....

[@IndigoNili]

Agreed! 😂

[@jmb5114]

Many new cooks value the experience of us "old dogs," and find the comparisons of cooking style results very helpful. Perhaps you enjoy criticizing or laughing at people, but those kinds of remarks are inappropriate here.

[@alexluvsfrogs]

@@jmb5114 I completely agree with you JM B, about old dogs having great cooking tricks and tips. That being said, I think you misunderstood my remark to begin with. I read several comments of people turning THEIR NOSES up to her newer ways. That is not why she made the video, to hear about how their ways are much better than hers... Old and new are great! People left her snippy unnecessary remarks that are irrelevant to what she is trying to teach or convey. Sometimes people just wanna add extra information to come across superior, which is rude of THEM. I Would never be so ignorant to make such a comment. My initial post was clearly not meant in the negative fashion in which you perceived it. I was merely giving her some support and food for thought before people post nonsense that isn't pertaining to what she is trying to achieve by posting this video. 6 other viewers seemed to understand what I meant....👍🏽 I wasn't rude to you so no need to be rude to me. You don't even know anything about my own "old school ways" ...anyways, no hard feelings on my end. Things are often misconstrued through text, but rudeness ALWAYS comes across clear!

[@jmb5114]

Frankly, I didn't see any rude or "superior" comments except yours. So go ahead - roll your eyes some more and call people silly again. You are correct that rudeness always comes across clear (sic).

[@alexluvsfrogs]

@@jmb5114 We can agree to disagree then. I'm not gonna act childish and fight on the internet. Never done it before and I refuse to start. God Bless and happy travels~~~

[@7389]

I just bought an Instant Pot a month ago. I love roasted chicken, but need the skin to be crispier. I am hoping Santa brings me a crisping lid for my Instant Pot. 🙂 Lemon and garlic are my favorite seasonings on chicken. I am going to serve it on top of homemade croutons so that the juices run into the croutons.

[@leandrogonzalez3729]

Just what I was looking for. Very well explained, super easy to understand. Thanks so much for your excellent video.

[@Rashmibhattachan]

In India ppl have been using this for hundreds of years! It's nice that finally this AMAZING cooker and the cooking technique is getting popular in the West. You guys can also check out HAWKINS PRESSURE COOKER.

[@elizabetholiviaclark]

Thank you kindly for making this video. I'd been thinking about buying an instant pot and was curious.

[@annieportier3584]

This was very informative. I don't have either appliance. Couldn't make up my mind which to buy! Thank-you so much for your time & trouble for this awesome demonstration!

[@pastorjustin4181]

Excellent side by side!!!! Thank You!!! I have two sizes of Cosori. Indoor Chikin kookin at is best, moist, tender, quick, easy cleanup!!! 20 stars!!

[@sesquashtwo]

I suggest one more step...for AWESOME pressure-cook chicken...at about 5 minutes time left to cook, put oven rack to the middle position, and then turn on your oven to 450 F. After your pressure release, place your chicken into the oven, and let the skin crisp up to your preference, by watching the process, and then remove from the oven, and ENJOY...crisp skin...wonderful mouth feel, and succulent chicken. (If you want, add some of your favorite B.B.Q. sauce to the chicken before you put into the oven for the 5 or so minutes crisping up the chicken will take). You will think that the chicken just came off of the grill!

[@babs2522]

Hi Nili, I have just come across your channel and I thank you for sharing this video. I'm going to buy a Instant pot on Friday and I'm looking forward in trying some of your recipe's. My husband and I are both disabled, we are not able to stand for long periods of time so we decided it was time to get a Instant pot. Take care from Scotland :)

[@IndigoNili]

Thanks so much for watching! I hope your new instant pot helps you both out tremendously! 💕

[@babs2522]

@@IndigoNili thank you

[@blondebailey9575]

Hi Babs! Yes my husband and I are also both disabled and cooking has become difficult for both of us. My Crockpot comes in handy for that but I want to buy the Instapot to have a couple of extra choices while cooking. I just had my 4th spine surgery, I'll be ordering this very soon.

[@carolr4871]

Great demo. I'm so glad you mentioned the size chickens you used.

[@rgruenhaus]

Nice video, but I will still use my Showtime rotisserie for whole roasting of chickens. It's about the same amount of time with the rise time to pressure and 10 minute NPR. Thanks for comparing and making me hungry! LOL

[@dingfeldersmurfalot4560]

Nothing beats rotisserie chicken, and I used to have one of those myself. It can be smoky and noisy, though, the bottom tray can fill with liquid and need careful watching, and overall the unit is nowhere near as easy to use. Those units are also very bulky. Whether you want to deal with all that in order to have the very best chicken is up to each person. The plusses are huge, but the minuses are also quite real.

[@romuloromero2268]

Do you 'set it and forget it" ? lol

[@Oc4ever12]

Wow, it's rare when I watch a video where ALL my questions were answered!!! You covered EVERYTHING! you must be a professional instructor!!!! Thanks so much for this video and for the written instructions! YOU'RE THE BEST!!!!☺☺☺

[@CoolCraftyCreations]

Thank you so much for sharing this video, just purchased the Instant Pot and am looking forward to cooking some great meals! Thanks again!

[@kuvodich2161]

Unless I’m mistaken, it looks like the instant pot was not quite up to temp when you started searing. I’ve done the exact same thing. Thank you for the video.

[@koko_7]

Thanks , I got new IP and first thing I want to make is whole chicken !! U made it easy , thanks again, I follow u from faraway all the way from Egypt. Lool , شكرا

[@amiyahjennifermarcial8332]

I made this today I have the Instant Pot, wow it was so juicy and tasty and I crisped the skin in the boiler Really really good! Also fast!!

[@gracel3320]

Thank you for doing this comparison video, I have two Instant Pots and really enjoy using them, but good to know there are other choices!🌷

[@sistakia33]

I watched this hoping to get a better understanding of which type of pot is the better investment. I think maybe I should see different types of dishes being prepared. I do thank you for your effort.

[@BlackPearlMinistries]

I've had a 6qt for a while now and just got my 8qt instant pot for Christmas. Love them both. I wanted one for main dish and one for sides so I could do both at the same time. I think you should do a tutorial on how to carve a chicken if you don't already have one.

[@maryjanewilson7425]

I’m

[@annecorey607]

This is very good quick and easy to use and lots of nice foods fresh healthy foods thanks

[@eliz964]

I LOVE Chosen Foods Avocado Oil. It's the best. I use it to make mayo and it's delish.

[@cliffcox7643]

I use the Searzall or Iwatani Torch to brown the whole bird, just to get color all around. You know, to look good, cause searing it misses all the crevices. Then still sear it to get flavor. Add celery at the bottom, Herbs du provence, and spuds, onions, salt free broth, thyme, rosemary, wine. Cook the same. and eat w toasted frenchy bread.

[@smileytow1925]

Great comparison! I love my instant pot! And I have learned so much from you! Thanks you! I love catching a glance and your baby Levi bump! So exciting!

[@verher63]

I've been wanting to buy an InstantPot, but wasn't sure how a baked chicken would turn out. Thank you for sharing.

[@littletime100]

Thanks for sharing the two side by side and I Learned something new as well,not to quick release meat. I did a boston butt and did quick release and maby that is why I thought it want quite as tender as slow cooker but it was good. Thanks for that tip.

[@najwaabdul-tawwab3592]

Standing rib eye roast

[@rkb930]

Excellent presentation, Indigo! Well-presented, clear, easily understood, excellent comparison of the two appliances. Thank you for sharing your time and expertise.

[@fabulouspinkmk10]

Enjoyed your vid very much, your voice and detail to explain the proscess of your demonstration, made it easy for me to follow you. 👍😁

[@ابوفيصل-ز5ط]

AASDFGHVBMKKHGFWERBBMKHGFEERVNMMGGFBMMGGRR SDDBMFDSERVNMKHGFREWVNMFDSSRRVNMHGRRBNMKHGFDERVNMGFSERFVNMIKGGRREEVBNM

[@SandysDIYHealthAdvocacy]

LOVE that you use avocado oil!

[@IndigoNili]

It's the best!

[@MH-rp8jx]

Great video, very concise and loaded with great info!

[@lizagarcia2117]

Do you prefer one pot over the other? Cost? Cleaning? Quality of materials? Love your video , chickens look great!

[@user-rc8eq9jq4f]

thanks for all your hard work in putting this video together, my wife and i are in the market for the instapot we both work full time and no children both chickens look awesome looking and basically look the same i look forward to watching more of your videos, when you cook your own chicken from scratch you know what your getting when i get an infection i just go to Costco, i here the chickens there already have the antibiotics in them.

[@pmboston]

Thanks for the six minute per pound chicken rule! This old dog is learning new tricks, never used a pressure cooker before, but I got an instant pot mini recently, and it’s a great device.

[@atopnotaryservice1017]

I have a 5 quart instant pot and I love it... thanks for the video

[@blackhatter011]

I have a 6 quart instant pot and I love it even more... thanks for the video

[@ServingUpSarcasm]

@@blackhatter011 i have a 7 quart instant pot and i love her

[@blackhatter011]

@@ServingUpSarcasm Oh yea, well I just bought an 8 quart instant pot and I love it even more than my six quart.

[@zarax5029]

@@blackhatter011 Well I have a 200-quart and I simply adore it so there's that.

[@blackhatter011]

@@zarax5029 I just bought the new 600 quart into the pot and I simply adore it.

[@BobRooney290]

i was thinking of getting a stovetop version. I wonder if the result would be the same? Also, there's the cost factor. A deli cooked rotisserie chicken is $5 at my local supermarket, but a raw chicken costs just as much or more, plus the cost of gas or electricity to cook for an hour. the raw ones might look bigger, but they are pumped with water to add weight, so it shrinks considerably after cooking.

[@kelliez9991]

Roasted chicken prices are kept low at Sam’s and Costco to bring shoppers in. Years ago, stores kept milk prices low to bring shoppers in. The idea is shopperswill pick up other items when they come in for the low priced necessity.

[@NotSoFast71]

They will crisp up quickly in an air fryer if you happen to have one. About 5 minutes or so on the highest setting.

[@spencerwilton5831]

Glenn Robertson so you suggest using two appliances, multiple steps, extra washing up? Why the hell wouldn't you just use the oven- a single roasting dish is all that's required. Chickens that would only take an hour, unattended. Very little washing up and a better result.

[@carolk6002]

I have never tried one of those but I like hearing comments from people who have one. It helps me decide about buying this device.

[@ruggabear]

@@carolk6002 Buy it! I just got mine last week and I LOVE it. I bought the Big Boss on Amazon. Haven't done any "frying" in it yet, but the meats have come out tender and juicy, perfectly done. We've used it every day, since it came out of the box!

[@carolk6002]

@@ruggabear ...I have a Cosoric type Instapot. Love it!

[@ruggabear]

@@carolk6002 Oops, I thought you meant the air fryer, that someone had commented on, above. I'm loving the Big Boss (air fryer) and the Instant Pot.

[@oysterman2517]

Thanks for the test. Which one to buy? I would go for the Cosori because it looks more expensive and I like the sound it makes. But the IP seems to be a bit easier to use (and faster). Cheers

[@marikomat]

Could you remove the Cosori trivet handle, turn the trivet upside down and put the chicken on it using the tripod legs as handles? Just a thought. ;)

[@yootoob4516]

Your suggestion is simple and brilliant! I'd like to add: if one removes the handle, screw the nut onto it, so it doesn't get lost!

[@DominiqueJOUNDA]

I bought an Aigostar (Unboxing video is up ), it is on the cheapie side. LOVING IT.