15 Years Old Hardworking Kid Selling FRENCH FRIES 🍟 Street Food Afghani Fries Recipe Making

[@eniuthegamer]

Respect for all hardworking boys in Afghanistan.

[@RashidaHussain]

Indeed! May Allah give him more success.

[@harukatakahashi8822]

How about Mexico?

[@z6aq708]

@@harukatakahashi8822fuck Mexico

[@HussainAhmed-h1k]

This isn't Afghanistan I think it's Pakistan the language is Urdu the car look familiar just so you know I live in Pakistan

[@shahidkhan-xn2bs]

ALLAH pak apko kamyab Kary y apky piyary or masum s hath jo struggling m lagy hoy h Ameen

[@yommmrr]

I wish him the best in life. He has a good work ethic.

[@RashidaHussain]

Yes! He is doing very well at this. May God grant him more success. Thanks for the comment 👍

[@-Pawuloniasty-]

Ethic? Maybe. Hygiene is worse...

[@SpeedFreak999]

Who gives a shit he's just a 15 year old boy ​@@-Pawuloniasty-

[@Pneuma6969]

sorry but how delusioned are you? you know where he lives? like, what circumstances they have, and what possabilitys? like, its not europe, america or russia or whatever, its afghanistan and from what ive seen here is still 1000x better than in india. o​@@-Pawuloniasty-

[@RAWhyte]

This Kid has got skills and talent, Insha-Allah when the boy grows up he Runs a successful Restaurant Business !! 😇👏🏽

[@RashidaHussain]

Indeed! I hope so. May Allah grant him success. Thank you for your valuable comment 👍

[@TheJono1170]

Haven’t got the skills of hygiene

[@DreamZeroYT]

@@TheJono1170 You can only comment but you Haven't got the skill of helping people

[@TheJono1170]

@@DreamZeroYT how am I supposed the help this prick

[@slaveoth5114]

Why saying Insha-Allah to an indian kid?

[@aniketsharma7832]

Such a hygienic potato cutting area

[@andrewb.9815]

I mean my man is hustling and working with what he has got.

[@kpadmirer]

The hot oil will kill the germs.

[@AndyRich2022]

That is what I call a hard working young man I give him all the respect keep going bro make your family proud

[@brentschmogbert]

It’s a child and he should be in school

[@Highskill3r]

thats not a young man that is a child my friend.. why is he not in a school?

[@Dripikdrippydipsdropkicks]

M8 he's getting more life skills doing this than any school in his country, American or anywhere else for that matter ​@@brentschmogbert

[@joaofelipe5470]

I am Brazilian and Greetings For Afeghanistan People ! 👏👏👏👏👏

[@RashidaHussain]

Wow from Brazil! I'm glad to hear that. Thank you for your valuable comment 👍

[@dorafurness466]

The container he is putting he fries in needs,a good scrubbing and never heard of putting flour on fries before. This young man knows what he's doing , hope he earns enough to help him and his family.

[@RashidaHussain]

Yes! He half-fries some fries, so when it's rush hour, he fries them whole, so that saves him time and the customers. He adds corn flour to make the fries crispy. May Allah give him more success. Thanks for the comment 👍

[@comicaiadventures]

WELL YOURE IGNORANT LOL

[@mahmoudsharif3864]

He adds corn flour to make it addictive and tasty so customers can come back all the time

[@tombruna4650]

Corn starch

[@mosaici.t.s8766]

Maybe not flour, but chipwhite.

[@tommyhassan3545]

Strong hard working boy I hope he makes millions

[@RashidaHussain]

Hope so! Thank you for the comment 👍

[@DjWellDressedMan]

Economic Child Exploitation, a Child should be in School learning

[@Smilemery]

@@DjWellDressedMan Lamentablemente no todos los niños tienen esa oportunidad

[@harukatakahashi8822]

​@@Smilemery like mexican kids

[@libastonprograms]

Nice video. That’s really fun. Great cooking. Thank you for your sharing. Have a great day my friend

[@RashidaHussain]

I'm glad you liked the video! Yes, he is doing very well at this age. Thank you for your valuable comment 👍

[@Mr.FOODIE2001]

Salute to this child😢

[@RashidaHussain]

Yes! He is doing very well at this age.

[@queenelcene638]

He looks younger than 15... still, more power to him😊❤🎉❤ Blessings be😊

[@RashidaHussain]

Yeah right! May God grant him more success. Thank you for the comment 👍

[@LatishaHenderson-cy1vq]

etuivfdsdhjxnmmjvxsrteyiiiopufzsxmm🎉❤😢😢😢😮😮😅😅😊z fsdfvgb ..dgtrwesbhnhdszsfgghbn mxssddgtretyyuujolhssdffghhffffgv mmweewddgfhczxvbnmm🎉🎉🎉❤😢😢😮😮😅wrrrraaaaddffhghreeyynmkksaassdxxzzvvbbnn.mnsdghhjytewqqqwqassdfggfvxxvnnnvdazjnzxcvbbm🎉🎉❤😂🎉🎉🎉😢😢😮😮😮😅😅😊saddddddzghcxhhasxxcvvbddadrrrtyyyeeryuioadkjgfnn to wwqqssdasxxxdfggvbbxzmrhuujogfsghhjxc 2:29 vbnmrrretyaassdasqwwsddfgvzxcbn🎉🎉😢😢😮😮😅❤❤❤😂😂

[@LatishaHenderson-cy1vq]

xfgffv🎉🎉😢😢😮😮

[@reii8929]

The way he works is so efficient and got steady hands for such work and such his age

[@RashidaHussain]

Yeah right! He is doing very well at this age. May God grant him more success. Thanks for the comment 👍

[@TechLiberator]

So proud of these hardworking dedicated people. God bless.

[@ChatoriAsiya]

Assalam u Alaikum bhai mai hamesha apki video sath jo add ate hey wo bhi dekhti hu Allah pak apko kamiyab karey Ameen

[@まろまろパディントン]

美味しそうですね〜😋💕頑張って！

[@overlockmaschine]

He has to be in the school. Not at work

[@aymn-art546]

This is all because of the corrupt countries that waged war in their countries, such as America, France and Russia. They are the cause of chaos everywhere

[@uqiesyukri7282]

Haters

[@SDtraining627]

School makes you poor.

[@kakibesi7760]

today is holiday...maybe part time job..take it easy,dude

[@dktdc]

Since you’re so concerned about his education, maybe you should put up the money to make sure that he gets proper education. Otherwise, he doesn’t need career advice from somebody farting behind the keyboard.

[@Wazi-Azimi]

Such a hardworking boy.

[@RashidaHussain]

Yes! He is doing very well at this age.

[@corneliuschew]

Definition of a true hustler 🔥🔥🔥💪🏻💪🏻💪🏻

[@4_4_4..]

ماشاء الله تبارك الرحمن.. سيكبر رجلا حقيقيا أسأل الله تعالى أن يوسع رزقه🇵🇸💚

[@DreadWing7777]

🙏A.M.E.N🙏

[@mettekesdg1538]

Ah good thickness of the fries, and bakes them twice! This Belgian is proud!

[@GeofferyBlevins]

🍔🤔🍟🍕😊🌮🍚🤗🥢🥱👛 8:50 I love it when y'all eating tha food! It makes me want to go travel there just to taste it yummy. Thanks you guys looks great keep up tha great work you guys.

[@RashidaHussain]

Wow! I'm glad you liked it. Very welcome and must try it. Thank you for watching and valuable comment 😇👍

[@axjacobsen295]

Enjoy your food poisoning

[@dhruvp.r7609]

The way he working hard and motivated to his job I hope a good life for him I’m sure that will come fatser

[@ChatoriAsiya]

Allah pak hamarey pakistan ke halat achey kar dey Ameen

[@kanaomar3375]

Our prayers are with you guys,insha Allah love from Kenya

[@ChatoriAsiya]

Thank you so much

[@LostDeadSoul]

The 10 year old kid has worked him self to the bone, working 25 houres a day the last 15 years. Amazing.

[@Deniel_]

Very healthy environment for food making. 👍

[@drinkmorewater8791]

LOL 😂

[@icmpeko]

It's cool, man - you can see he uses plenty of delousing powder after cutting the potatoes 🤔💥🪰🪰💥

[@v.richard9993]

Seeing how food in china is made im glad this people earn their pay with honest work

[@talatsadique4242]

Hope one day you will become a millionaire ❤

[@queenelcene638]

Billionaire, 😮😮😮lol😊❤🎉❤

[@BryanLai999]

Good job kid . U selling food and always keep ur work station clean i love that !

[@RolisHerbandez]

This kid is more grown than most grown folks nowadays 😒

[@anloff]

like he had any other choice.... be reapectful

[@AdrewMeyers]

very hardworking kid with crunchy and tasty fries keep up the good work son

[@tedbell4416]

Thanks dad

[@feffy2149]

8:10 i thought the fly was another ingredient 😅

[@biswajithalder8640]

One day he'll be a millionaire cause hardwork never waste. Love from India ❤🇮🇳

[@teslamodel3201]

Blenchod, Hardwork is different from Smartwork.

[@mieszkowisniewski835]

Full of respect for this young man... hard work and pasion make him rich some day, i hope for that ;)

[@RashidaHussain]

I hope so! He is doing very well at this age. May God grant him more success. Thanks for the comment 👍

[@mieszkowisniewski835]

@@RashidaHussain welcome... Always I am full of respect for peoples who doing something good in their lives. In my opinion this boy is also a motivation for someone... Many thanks for this video

[@Opandort]

Wish all the best for him. He was literally better than me when i was the same his age. 👏🏻

[@divyangkamble7918]

French fries along with french flies 😂

[@uqiesyukri7282]

Haters alert

[@tommyhassan3545]

Jealous mug

[@Varenozz]

useless kid in the family, u only can ask money to ur parent, candy boys 😂

[@CALILIFE8251]

Come on guys he’s just adding some humor 😂

[@14k46]

@@CALILIFE8251 lol

[@Cristobal_300ZX]

Good work ethic and good food too! Kid works harder than most adults I know here in the USA. Humble beginnings... I wish him the best on his future!

[@RashidaHussain]

I'm glad to hear that! Yes, he is doing very well at this age. May God grant him more success. Thank you for your wishes and valuable comment, stay tuned 👍

[@TheKuolin]

Amazing Kid❤ .. Later will be success..❤

[@RashidaHussain]

Yes! He is doing very well at this age. InshaAllah! May God grant him more success.

[@zazouzaza7452]

SobhaAllah même des enfants valeureux qui travaillent vous les critiquez

[@RashidaHussain]

Oui! tu as raison. Ne vous concentrez pas sur les paroles des gens, c'est le travail des gens de dire.

[@eliseuoliveira2371]

Bom dia,tiro o chapéu pra o menino, como ele é muito trabalhador e inteligente, ele faz serviço de adulto 😮

[@zharenaya_kartoshka]

What's the white powder he mixes into the fries.

[@wolfgan3ruption]

He said in another comment it is corn flour

[@nealwilliam]

0:12 His fast cut potato fries 🤔

[@AramK]

Best of luck to this kid. Hope he will succeed in life.

[@gyaltsengoh1259]

He might succeed with a fast food chain

[@Duwap1017]

went from 8 to 15 in 2 years .. amazing

[@deagle2yadome696]

what do you mean

[@sui9452]

🤣🤣

[@ChatoriAsiya]

Bhai kabhi hamari mobile shop per bhi aae hamey bohut khushi hogi

[@jayjoshi479]

He has excellent work ethic he's an authentic young man.

[@EtSlagFisse]

Humble humans. It's easy to take for granted what we have sometimes. Some kids these days already have ipads and computers as soon as they learn to walk.

[@RashidaHussain]

Indeed! Some get it without asking, some have to ask and some have to take it themselves.

[@antonioaguilar7542]

What is the white powder in the beginning?

[@RashidaHussain]

This is corn flour.

[@neguel1165]

And our children are so lazy to wake up in the morning to go to school.. ☹️.. those childs like him are real human with strength. Big respect

[@nopelindoputraperkasa5869]

Nice sharing Vidio..very inspiring and creatif.. good luck.. masyallah 🇮🇩🌺🌼👍👍

[@kantisolanki642]

भाई टामेटा केचअप हरी‌ चटणी‌ मसाला चाट‌ उसके‌ शीवा‌ क्या डालते‌ हो‌ वाईट‌ वाला‌ ओर दुसरा‌ क्या मसाला डालते‌ हो‌

[@Rollin-With-Kirk]

mmmm Flies with some Fry's! Double protein yummmy.. Keep up the work..

[@e9..]

اللهم بارك للفتى ووسع له ابواب رزقك يا ارحم الراحمين تحياتي للباكستان 🇸🇦

[@Pashtun.Taraki]

و الله يقوي المسلمين. لتحرير الأماكن المقدسة للمنافقين الإسلام

[@poseidon9916]

Much love from Brazil

[@bestkksser]

I pray whoever eyes catch this God give you the strength you need to overcome every battle your facing may the dark thoughts and overthinking,my be peace and calmness fill in your life🇧🇸❤️

[@跡月]

Sorry, after watching your video, I became interested in international foods. Could you please tell me what seasonings are added to french fries? THX

[@RashidaHussain]

Everyone adds different spices! This boy adds chaat masala and chicken flavored masala.

[@跡月]

@@RashidaHussain Ah, I see! This type of seasoning isn't commonly found in Taiwan. I heard that most of the spices used in Taiwan are actually imported from your region. Thank you for your answers.

[@Jhankiel]

Ese niño trabajando desde tan joven, será un hombre adulto de bien 😊👏

[@RashidaHussain]

¡Sí! Le va muy bien a esta edad. Que Dios le conceda más éxitos. Gracias por mirar, estad atentos para más vídeos callejeros.

[@макаркривоносов-з6ъ]

@@RashidaHussain ииииииииииииииии

[@thegeneralscience6040]

​@@RashidaHussain sir I'm from India I want that potato cutting machine and we can make

[@Ms-fb4sw]

Can we get a successful restaurant owner to notice him and maybe help him! May Allah bless him and his family.

[@StreetFoodSection]

Hardworking and inspiring for others 😍

[@tedbell4416]

God bless the White man

[@user-ry2cv9yb3y]

Hardworking is better than school 👺👍

[@edwardcastrillo6577]

Awesome talent ❤❤ done fullwatch your video. New friend here

[@foxtrail975]

Actually this boy is not cursed for being poor but actually blessed by the almighty…he will grow up to be a strong independent guy…by the way is this Pakistan or Afghanistan…because his fries look yummier than McDonald’s….I will get a visa and book flights to eat his French fries…no kidding!!

[@RashidaHussain]

Haha very welcome and must try it. Yeah right, he is doing very well and earns halal money, and also supports his family. This video is from Pakistan but this boy belongs to Afghanistan. Thank you for the comment, stay tuned for more street videos 👍

[@foxtrail975]

@@RashidaHussain Being an Indian, I don’t know whether Pakistan embassy will give me a visa and I don’t know the current situation in Pakistan…is it safe for Indians??…I need to have a friend in Pakistan who can protect me otherwise it’s too dangerous…

[@Agnet_Faze]

Yeah 😂 by not going to school he will become an independent guy... Nice joke man nice joke...According to you, he should not go to school...And still sit there to sell french fries and serve you and until he serves you he is blessed...Lol where do these people come from? I don't understand...

[@foxtrail975]

@@Agnet_Faze Are you stupid or what..did I ever say that he should not go to school and sell French fries…you keep assuming things on your own…when did I say he is blessed until he keeps serving people??…where do people like you come from making stupid perceptions about what others comment….so dumb you are!!!

[@TWay-yf5zm]

​@@Agnet_FazeIndian countries be like:

[@cristianetorchesenkavabata]

He is a beautiful boy and champion😊

[@RashidaHussain]

Yes! He is doing very well at this age. May God grant him more success. Thanks for the comment 👍

[@cristianetorchesenkavabata]

🥰

[@AccuphaseMan]

Do the flies add to the flavour?

[@RashidaHussain]

Haha, no way!

[@Gccgg-if2td]

Картошечка в условиях антисанитарии да на пальмовом масле, мм вкусно а!

[@Zadumych]

Зато сколько приправы летает мясной =)

[@frankcarone6]

wow!!fantastic job ,hard working young man

[@anthonyn9935]

Fries and flys

[@vijaykumar-pk5qi]

Bhagwan is bache ko khoob taraki de

[@thomasheise5112]

Einfach Klasse, dieser junge Mann hat eine große Zukunft vor sich. 👍❤️

[@a.Bit.of.Fried.Halloumi.Lovely]

great future yeah sure mate..😅

[@axjacobsen295]

Frittenkoch... Herr Heise, zu mehr haben Sie es scheinbar auch nicht gebracht.

[@thomasheise5112]

​@@axjacobsen295keine ahnung wo ihr problem liegt aber ich habe keines. :) Überall auf der Welt werden Pommes verkauft, ist das jetzt was schlimmes?

[@TWay-yf5zm]

Great future, ahahah

[@hakdog1905]

I hope ppl who eats those fries don't get sick.. Mosquitoes everywhere, and potatoes are on a sack, wasn't even washed.

[@silmaradasilva1212]

Delícia batatas fritas, parabéns para o garotinho ele é muito habilidoso.🍟🍟🍟🍟😋👏👏👏🤗🇧🇷

[@RashidaHussain]

Sim! Ele está muito bem nessa idade e deixa as batatas fritas saborosas. Obrigado pelo seu valioso comentário. Fique ligado para mais vídeos de rua.

[@alexmonteiro4267]

Nunca vi tanta mosca....dá medo viu.

[@marcosgorreri8532]

E porco tambem

[@JohnnP7]

​@@alexmonteiro4267infelizmente lá é assim..

[@Paulatejando66]

Vai comer, de lá vc não volta kkkkk

[@Самирасабитова-к1ъ]

Молодец продолжай дальше работать учись ✊ и классный мальчик❤❤

[@RashidaHussain]

Да! В этом возрасте он чувствует себя очень хорошо. Дай Бог ему дальнейших успехов. Спасибо за комментарий, следите за обновлениями уличных видео.

[@Самирасабитова-к1ъ]

@@RashidaHussain ♥️♥️🙏🔥

[@pjvera]

They're making French Fries. They are so yummy!

[@axjacobsen295]

No, those are actually pancakes

[@causetheplumstasteyum7848]

They actually are not , hence why they are covering them in sauces

[@melissariosordaz9865]

QUE BUENO, LAS MOSCAS SON GRATIS

[@ZakKeyChik]

I am generally silent about sanitary languages. The guy is good at working, but hygiene and sanitation are most important to me!

[@justlilss]

This young chef boy is fascinating with his French Fries cooking, more later about his hardwork can relate on his own best. Love from Philippines

[@NazriB]

Lies again? Driver Chauffeur USD SGD

[@eddiekang_95]

May Allah grant him prosperity. 🙏🏼

[@andrewmoore7927]

Do the flies and black cooking oil cost extra?

[@AzilAmaar]

There is black oil in your local restaurant too loll go check behind the scene videos on youtube 😅

[@TWay-yf5zm]

​@@AzilAmaarstop defending that boy

[@joejohn7840]

Kid works harder then most Americans i know. Myself included.

[@brianb8498]

If he’s 15 than I was born on Mars

[@miragebangbravern]

In my school back when I was 15, everyone looked younger for their ages for the most part. It's not like in western countries where a 15 year old can look like someone in their early 20's.

[@kantisolanki642]

भाई टामेटा‌ केचअप ओर चाट‌ मसाला ओर क्या डाला‌ है

[@hasanalbannaelkirsh7748]

بسم الله ماشاء الله...دول اللى يعتمد عليهم

[@adnmrls6450]

Good job!! Some People say has to be in school.. but they don't live there. They don't even know what is happening in there

[@shadow_of_darkness5666]

Man. This kid works better than I do. I'm humbled. May all work in your favor. 🧎🙏

[@wp2746]

Still better than at Burger King, well done. Love the Indians being frugal with their ingredients.

[@tedbell4416]

Nah burger king is better

[@9-volt247]

He is a skilled child. God Bless him. 🙏🙏🙏

[@GeneticXIV]

The bugs buzzing around make it look much more appetizing!

[@maliespetersen2674]

Es ist ein nicht einfaches Leben für die jungen Menschen. Doch sie versuchen mit ihrer Arbeit der Familie zu helfen. Ich habe Respekt vor vor der harten Arbeit dieses Jungen, der eigentlich in die Schule gehört. Doch die Umstände..... Seien wir doch für alles Gute bei uns dakbar.

[@RashidaHussain]

Ja, genau! In diesem Alter geht es ihm sehr gut. Möge Gott ihm mehr Erfolg schenken. Vielen Dank für Ihren wertvollen Kommentar. Bleiben Sie dran für weitere Straßenvideos.

[@kamikasekase1422]

Welldone he already know how to survive at young age

[@RashidaHussain]

Yeah right! May God grant him more success. Thanks for the comment 👍

[@mahmoudsharif3864]

Pakistanis are hard working. No wonder why they become successful when they come to the west .

[@FPL_UPROAR]

flies included!

[@fahadafridi8]

ye kaha per hai Peshawar mai hai??

[@uqiesyukri7282]

I will eat that..looks yummy..🤩

[@Goodbyemyfriend-vk9lo]

Keep Up The Good Work Brother 👍🏽

[@LurkerDood]

Too many flies Someone buy the kid some fly zappers

[@ownSystem]

One day this boy will own his own potato farm and empire :)

[@RashidaHussain]

Hope so! May God grant him more success. Thanks for the comment 👍

[@ownSystem]

@@RashidaHussain hes got the positive energy:) and can do spirit will become a true dream keep working and do great things :)

[@eddevil8317]

es la cocina más limpia que veo de todos, el niño es muy sistemático y dedicado a lo que hace.

[@RashidaHussain]

¡Sí claro! Le va muy bien a esta edad. Que Dios le conceda más éxitos. Gracias por mirar, estad atentos para más vídeos callejeros.

[@z-iroc9932]

Está llena de moscas seas mamon

[@Jesse-Studio]

Yummy! I love french fries! 🥲👍💯

[@ЖекаЛ-у7о]

Антисанитария писец какая!!! Картоху с мухами я бы не стал пробовать

[@tufailqureshi8624]

محنت میں عظمت