Broccoli + Eggs, 😮 Didn't think that it will be this much amazing || Broccoli Omelette recipe

#broccoliomlette #broccolirecipe #omelette #tastyhours
#lchfrecipe #ketorecipe
#tortilla
Other broccoli recipies
***********************
1. • 🥦 Broccoli Crepes / Un...
2. • Creamy Broccoli Shrimp...
3. • 🥦 Garlic Broccoli Reci...

[@jrch5563]

I love the birds instead of the music and the sound of chopping and noises from the kitchen while preparing the food. Much more relaxing and less busy noise.

[@TastyHours]

Thank you 😊

[@rahulvidhate23]

No waste of time in intros, no off topic talks, no stupid music. Straight to the point, awesome recipe, and peaceful ambient background sound. Instant like and sub👍

[@TastyHours]

Thank you 😊

[@ranjitdesai5254]

Couldn't agree more!

[@markp4767]

Please pleaseeee next time also give Measurements in Metric, given those are universal measurements on this planet, rather than just a country or 2. But this is such simple brilliant and healthy recipie to include fresh veggie. I also add some grated Parmeggiano reggiano, or adapt other ingredients into it like sun dried tomatoes or olives. Thanks for this 🖖🏾

[@rogerforest1729]

i know im asking randomly but does any of you know a tool to get back into an instagram account? I stupidly forgot my account password. I would appreciate any tricks you can give me!

[@danecalvin3339]

@Roger Forest Instablaster ;)

[@kajalsingh9554]

This looks amazing. I have broccoli, and will be making this tomorrow for lunch. I may add some cheese. thank you for making this video.

[@harilal1441]

Wow... This is a very good recipe for me.

[@ayemi2556]

Good looking,that must be very tasteful.Thanks for sharing.

[@khoetranst..4391]

very good .yummy yummy .i like it .Thanks for sharing .

[@cookunnyne]

완전 대만족 레시피입니다~~ Broccoli and egg!!! What a unique recipe♡♡♡

[@veenamanjunathan3109]

Great and delicious .. looks puffy and yummy

[@naeemahmed23999]

Excellent and maked short time

[@Exiria]

Beautiful color

[@TastyHours]

Thank you 😊

[@chantaltulliez8066]

shall make it looks delicious and healthy...thank you for sharing...

[@glendaliquiran]

i wanna try this healthy and simple dish, thanks for the new idea.

[@phoebezhong967]

Thanks for ur sharing ❤️

[@rmnathan5923]

Very nice n delicious.... Tq

[@aayushscreativity3842]

Unique..I will definitely try

[@TastyHours]

Thank you 😊

[@caminodesantiago9376]

looks easy and delicious, low carbs , I will try it tomorrow

[@TastyHours]

Thank you 😊

[@KayDejaVu]

I made this with Just Egg and it was good. I am not totally vegan but love the option to omit eggs. So much you can add to this.

[@BiSAYANGiGAT]

Undeniably healthy and delicious at the same time

[@deliciouscookingvlog8261]

Waw sooo Good.. Love to try this

[@almaztsegaye8791]

Thank your 4 sharing

[@RizaDabon]

I will try this thanks for sharing

[@TastyHours]

🤗

[@neetaskitchen1857]

Looks healthy tasty recipe big lykee 👌 thanks

[@independentnews308]

Excellent food

[@carlsapartments8931]

awesome... i'm hungry

[@AliyahandMommyLDR]

wow omelette broccili looks yummy. i must try this too

[@tahasorkati5936]

this is nice N healthy thanks

[@TastyHours]

Thank you

[@elizabethdrummond9581]

VERY NICE AND HEALTHY

[@TastyHours]

Thank you 😊

[@kishorerama1430]

Wow healthy recipe

[@KoreaWalkingVlog]

Looks so delicious. I will try to make it. Thanks for nice video.

[@saravlogs986]

Wow looks very nice

[@simplengbuhayngmaybahay5369]

very healthy thank you for sharing I will try this support and connected

[@NovelKitchen]

Healthy broccoli Omlette

[@samaykulkarni5496]

wow great. i liked the recipe when i tried it. thanks a lot

[@aiit-n3v]

Bravot c'est une très bonne cuisine bon courage

[@TastyHours]

Thank you

[@maryngshwuling9916]

Thanks for sharing this recipe 🌈

[@TastyHours]

You are welcome ☺️

[@varshikaskitchenlifestyletamil]

Delicious egg with broccoli....Yum....Yum....

[@chafrewilcha]

This was very tasty!! I've found another great addition for breakfast ... and as a side for lunch or dinner ... or for a late night healthy snack. Thanks a million!

[@sandanammary3241]

Thank you for recipe

[@TastyHours]

You are welcome ☺️

[@palobar9974]

Excellent! Thank you for sharing this recipe.

[@DeCookingTouch]

very nice presentation and looks yummy

[@FilipinaVanLifeAubry]

I got broccoli I should try this. Thanks for sharing this recipe

[@jamalalexandar2583]

Amazing videos

[@radhikaan2863]

Vgud recipe..I prepared this delicious item..my whole family becomes fans of it.

[@MamatasPavilion]

Green Keto like diet ! superb omlette idea and the qty of broccoli you used is excellent , very healthy breakfast idea ! thanks for sharing, always enjoy watching you at work !

[@parviish]

Wow looks so yummyy😋

[@PravisTasteAndTravel]

Very nice recipe, looking good 👍

[@SameenasCookery]

wow!! very healthy protein rich recipe

[@JeanSimpleLife]

love this.. must try with malunggay leaves :)

[@newlifethaius4281]

This amazing idea. I’m going to make it thanks for sharing .

[@shagunmittal5551]

Loved it. Came out very nice

[@TastyHours]

Thank you 😊

[@newboy2422]

brokoli recipe super

[@nataliah4478]

it looks very good! i will try

[@healthy_foodcooking]

WOW nice I will try it

[@RecipesbyNabilMum]

Sooooo yummy recipe Just wow yummy recipe 👌👌👌❤️❤️❤️❤️

[@tatafouzia3543]

Looks délicieux yummy mmmy brocoli wow beautiful recipe blz connecte Thank you so much welcome

[@harshithaartscrafts]

It looks very colourful

[@DINNERUSA]

looks so yummy

[@specialkhanay2359]

Like #35👍😍 Very nice video great share yummy and delicious recipe. I will definitely try to make it . Keep up the good work . You are a great cook 👩‍🍳 💙💚❤️😘🥰💕

[@Dhspat]

Yummy. ☘️☘️☘️☘️☘️

[@mirzaraziabaig1800]

Very very nice

[@aliciauvangkitchen9880]

Greetings from Malaysia... Your broccoli omelette looks super delicious & nicely prepared... perfect for a healthy breakfast...thanks for sharing this great recipe...

[@roselilly4897]

Great recipe! Perfect way to get in vegetables! 👍👍

[@ShielaMarieJacinto]

Healthy recipe, I will try it👍

[@simpleruralfood9544]

Just Excellent !! Delicious ???? Yummy ??? Tasty ??

[@libmananchannel]

Nice cooking channel! Nice recipe! I enjoyed it very much!

[@wellbeinglife6037]

Wow ~~~ Looks very healthy and delicious food. Thank you my friend.

[@zeynabmolai6787]

سلام واقعا عالی 🌹🌹🌹🌹🌹

[@hyeja_tube3157]

Very healthy broccoli omelette

[@jasinthagunawardana328]

Great recipe 🌹

[@simplecooking192]

Colorful , healthy and super yummy omelette. I must try cooking this too. big likes!

[@fuugawa741]

I must try this.. Tq

[@dhruvbhatt1876]

Good idea , thanks chef.

[@stephylee7967]

I just cooked this for my breakfast. It was so good and healthy!

[@sabasaba1682]

Amazing. Soo delicious

[@limewalk6719]

Great recipe. Thanks for sharing :)

[@rubychannel1113]

Wow tq, awesome recipe😘👌👍

[@Mavischosen]

wow my friend this egg and broccoli look so awesome very colorful

[@fabulousirene]

Awesome recipe. Thank You so much for sharing dear and have a wonderful weekend dear

[@rajamallaiahedla3843]

Nice idea

[@TastyHours]

Thank you

[@alimed6249]

Très bien bravot

[@delta201delta201]

Fantastic

[@nooor1120]

Yummy Thanks

[@ottowang7503]

Great for Keto.

[@jamshirana7747]

ഓംലറ്റ് റെസിപ്പി സൂപ്പർ ആയിട്ടുണ്ട് 😋😋

[@secretsofthekitchen1439]

You are Super ! ! ! Good Luck ! ! ! Thank you very much for this video ! ! !

[@user-yv9cs6bs4u]

Ok looks very delicious and that’s made me get up and make my breakfast now.Thanks.

[@TastyHours]

Thank you dear 😊

[@flavoursshore8600]

Wooww.. healthy n yummy recipe

[@ParuzzPlanet]

Healthy and tasty 😋😋😋 yummy lk12

[@Navaneetnavaneet]

Simple. Presentation so attractive. I was looking for a simple, easy to cook recipe. Thank you

[@TastyHours]

Thank you for watching.

[@sumaskitchen8269]

Nice recipe

[@pk2030]

I will try this👍😋

[@WoderMomOfficial]

Like 👍👍 very tasty and healthy recipe 😋😋😋

[@livyintheskywithdragons]

Hmm looks real tasty, I’m going to try it! ⭐️⭐️

[@paulinecheng3004]

😋😋😋👍👍👍👍🤗🤗🤗😄😄😄 thx for sharing, this's my new 'discovery' . Wonderful!!

[@vio5054]

👍🏾nice one I'll try it

[@bagusnisavlog9853]

Nice... always success your content

[@puspashreenayak6730]

It looks yummy 😋 will make tomorrow

[@TastyHours]

Thank you 😊

[@pandiselviveeramani5550]

Super I liked it

[@pmehta4452]

Bravo!

[@bluelilly22222]

It's looking like an beautiful jewel.. 👌👍❤😋😋😋

[@TastyHours]

Thank you 😊 👍🏻

[@thecatofjoy3686]

It's an Emeraldette. An emerald omelette ☺️💚🍳🤤

[@bluelilly22222]

@@thecatofjoy3686 yes